[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87932.1
DDBJ      :             transcriptional regulator, LysR family
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  669/915 : Eukaryota  11/199 : Viruses  1/175   --->[See Alignment]
a.4.5c.94.1
:300 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->297 3hhgE PDBj 1e-35 31.7 %
:RPS:PDB   1->231 1b9nB PDBj 2e-31 8.1 %
:RPS:SCOP  1->107 1b9mA1  a.4.5.8 * 1e-24 16.8 %
:RPS:SCOP  90->293 1al3A  c.94.1.1 * 1e-20 18.5 %
:HMM:SCOP  3->116 1b9mA1 a.4.5.8 * 6.7e-26 41.1 %
:HMM:SCOP  90->298 1al3A_ c.94.1.1 * 1.8e-39 26.8 %
:RPS:PFM   9->66 PF00126 * HTH_1 4e-15 60.3 %
:RPS:PFM   93->250 PF03466 * LysR_substrate 1e-07 29.2 %
:HMM:PFM   92->294 PF03466 * LysR_substrate 4.6e-40 28.4 197/209  
:HMM:PFM   7->66 PF00126 * HTH_1 5.5e-27 58.3 60/60  
:BLT:SWISS 8->291 YAFC_ECOLI 9e-38 33.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87932.1 GT:GENE AAK87932.1 GT:PRODUCT transcriptional regulator, LysR family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2162154..2163056 GB:FROM 2162154 GB:TO 2163056 GB:DIRECTION + GB:PRODUCT transcriptional regulator, LysR family GB:PROTEIN_ID AAK87932.1 GB:DB_XREF GI:15157334 LENGTH 300 SQ:AASEQ MAMPLDWDKLRIFHAAAEAGSFTHAADKLHLSQSAISRQVSALEQDVGVKLFHRHARGLILTEQGELLYRTAHDVLLKLETVKMQLTETTEKPSGKLRVTTTVGLGQGWLTDKVQEFLQLYPEMSIQLILDNEELDVNMRHADCAIRLRQPQQSDLIQRKLFTVHMHVYAAPSYINRHGEPQSVEDLDNHRIISFGEPAPNYLLDVNWLENAGRSSDNTRIPHLQINSQTSIKRACLLGIGIACLPDYIVGRDPGLIQLSLAADIPSFDTYFCYPDEMKNAAKLKAFRDFIVAKARNWNF GT:EXON 1|1-300:0| BL:SWS:NREP 1 BL:SWS:REP 8->291|YAFC_ECOLI|9e-38|33.0|276/304| BL:PDB:NREP 1 BL:PDB:REP 3->297|3hhgE|1e-35|31.7|290/297| RP:PDB:NREP 1 RP:PDB:REP 1->231|1b9nB|2e-31|8.1|223/245| RP:PFM:NREP 2 RP:PFM:REP 9->66|PF00126|4e-15|60.3|58/60|HTH_1| RP:PFM:REP 93->250|PF03466|1e-07|29.2|154/207|LysR_substrate| HM:PFM:NREP 2 HM:PFM:REP 92->294|PF03466|4.6e-40|28.4|197/209|LysR_substrate| HM:PFM:REP 7->66|PF00126|5.5e-27|58.3|60/60|HTH_1| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 2 RP:SCP:REP 1->107|1b9mA1|1e-24|16.8|107/122|a.4.5.8| RP:SCP:REP 90->293|1al3A|1e-20|18.5|200/237|c.94.1.1| HM:SCP:REP 3->116|1b9mA1|6.7e-26|41.1|107/0|a.4.5.8|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 90->298|1al3A_|1.8e-39|26.8|205/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 10596 OP:NHOMOORG 685 OP:PATTERN -------------------------------------111-------------1-------------- 244-41-2334---322----2---9------21112CJI-2141-11---1645-15--211-43C3954-------1126211111---1-1-------6-1-3-2-2---------------1--------1-56623---21B436555232211111135396552111111111111-11-----43D888887A838697A774BABF989233A552544443KT1222222-2222222411241222332-212552232-22--21-1----------11111111111----------------111-----227B444445423214442222931-15352177541212411121-12412P55711111SAfUW66DAG7FBCCCCBADABDW-HPSIFcLUOuA1*iiSkoZ**yrpaV8A8AQWGBEJDQUCBCCCCCCFKHCA88B-----------------------------11CMA6K*rW*******lgkkh****tttuU****v***-3kejHFRMN*NoL*LEUE689AdC33444444545OG5321224211A334-1--4341317A3BBP-21----------------------1177WORCADjAJIDGRRRPBNTRNNIQNTUKbW1--44281-----PJKa7PNIIJIIHIGHF-JHHHLGEHIHJGLGHHHHCq*oXT7EEKDIHIHKIIHIHKHHG*CABBCCB8-MBBBCCCABCCC---4-2--2344435bQl988E4L255546434YYZYbGL6B9f8****s***cwz*tIgfk5633376466MTRiMMMMMOYWOOcfHKMKJ45541111-21----------------------------------------------------291 -------------1---------------------------------------------------------------------------------------------------------------------------------1--------------7----5------G--5-1--------12--D-----8---- --------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------- STR:NPRED 298 STR:RPRED 99.3 SQ:SECSTR TEEEEcHHHHHHHHHHHHHccHHHHHHHHTccHHHHHHHHHHHHHHHTcccccccccHEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcTTccccccHHHHHHHHTTTTccccccEEEEEEEcccEEEEEETTcccEEEEEccHHHHHHHTccTTcEEEEEEcGGGcEEEccHHHHTTccEEEEEEEEEEEEcccEEEEEEEcTTccEEEEEEEGGGcTTccTTcEEEEEEcHHHHHHHTccEEEEEGGGcTTcTTcEEEEccTTcccEEEEEEEETTccccHHHHHHHHHHcTTccTc## DISOP:02AL 1-3, 86-90| PSIPRED ccccccHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHcccEEEEcccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccHHHHHHHHHHHHHHHHHHccccEEEEEEccccccHHHccEEEEEEEccccccccEEEEEccccEEEEEcHHHHHcccccccHHHHccccEEEEEcccccccccHHHHcccccEEEEEEcccEEEccHHHHHHHHHHcccEEEHHHHHHHHccccEEEccccccccccEEEEEcccccccHHHHHHHHHHHHHHHcccc //