[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87933.2
DDBJ      :             transcriptional regulator, ArsR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  112/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:96 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   10->87 3cuoD PDBj 3e-05 38.8 %
:RPS:PDB   12->92 1bibA PDBj 3e-09 18.3 %
:RPS:SCOP  4->95 1fnnA1  a.4.5.11 * 2e-12 9.9 %
:HMM:SCOP  2->94 1u2wA1 a.4.5.5 * 1.7e-14 41.5 %
:RPS:PFM   13->67 PF01022 * HTH_5 2e-04 54.5 %
:HMM:PFM   48->69 PF01022 * HTH_5 3.9e-08 63.6 22/47  
:BLT:SWISS 1->96 YBZH_BACSU 3e-17 39.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87933.2 GT:GENE AAK87933.2 GT:PRODUCT transcriptional regulator, ArsR family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2163657..2163947 GB:FROM 2163657 GB:TO 2163947 GB:DIRECTION + GB:PRODUCT transcriptional regulator, ArsR family GB:PROTEIN_ID AAK87933.2 GB:DB_XREF GI:159140366 LENGTH 96 SQ:AASEQ MNPEEVLKALSHPARLKFLEWLKNPESHFCQEHPLSMGVCANQFQISGLSQSTVSSHLAVLQAAGLIRSKKVGQWVFFERNEETIDAFRHYLQANL GT:EXON 1|1-96:0| BL:SWS:NREP 1 BL:SWS:REP 1->96|YBZH_BACSU|3e-17|39.6|96/100| BL:PDB:NREP 1 BL:PDB:REP 10->87|3cuoD|3e-05|38.8|67/94| RP:PDB:NREP 1 RP:PDB:REP 12->92|1bibA|3e-09|18.3|71/294| RP:PFM:NREP 1 RP:PFM:REP 13->67|PF01022|2e-04|54.5|44/47|HTH_5| HM:PFM:NREP 1 HM:PFM:REP 48->69|PF01022|3.9e-08|63.6|22/47|HTH_5| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01022|IPR001845| GO:PFM GO:0005622|"GO:intracellular"|PF01022|IPR001845| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01022|IPR001845| RP:SCP:NREP 1 RP:SCP:REP 4->95|1fnnA1|2e-12|9.9|81/103|a.4.5.11| HM:SCP:REP 2->94|1u2wA1|1.7e-14|41.5|82/0|a.4.5.5|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 129 OP:NHOMOORG 112 OP:PATTERN -------------------------------------------------------------------- -------------------------------------211-----------------------------1-------------------------------1---1---1-----------------------------------------------------------------------------------2-------------1-1-1--1--11----1-------2----------------------------1---------------1--------------------------------------------------------------------------1-----------------------------------1----------11111111111----------2--111111-11111------------1----------1------------------------------------------111111111111111122121111-1311-1------------------11---1--------------1-----------------------------------1--------------------------1----------------------------------------------1---------------------------------11---------------------------------------------------111--------1-----------1111111---2-1211112122111-222-------------1----------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 96 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHccHcHHHHHHHHHHTTccEEHHHcccccHHHHHHHHTcHTccHHHHHHHHHHHHHTTcccEEETTTEEEcccccccccHHHHHHEEEE PSIPRED ccHHHHHHHHccHHHHHHHHHHHcccccccHHccccHHHHHHHHHHccccHHHHHHHHHHHHHcccEEEEEEccEEEEEEcHHHHHHHHHHHHHHc //