[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87938.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:88 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   61->81 PF09005 * DUF1897 0.00031 52.4 21/38  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87938.2 GT:GENE AAK87938.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2167991..2168257) GB:FROM 2167991 GB:TO 2168257 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87938.2 GB:DB_XREF GI:159140369 LENGTH 88 SQ:AASEQ MTKVVYEIVEHDGGFAYRMNGAYSETFPTYADAVEAARIVAAEQQVGGDDEEISYQDERGQWHEEYSQGGDRPEAEVVDKTTDLARPF GT:EXON 1|1-88:0| SEG 31->46|adaveaarivaaeqqv| HM:PFM:NREP 1 HM:PFM:REP 61->81|PF09005|0.00031|52.4|21/38|DUF1897| OP:NHOMO 28 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1-----1-11--------------11-11-1111--111111-13122------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,42-49| PSIPRED ccEEEEEEEEccccEEEEEccccccccccHHHHHHHHHHHHHHHHcccccccEEEEccccccHHHHHcccccccEEEEEccccccccc //