[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87947.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.34.11
:199 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  22->87 1m9sA3  b.34.11.1 * 4e-07 19.7 %
:RPS:PFM   143->197 PF06823 * DUF1236 1e-05 50.9 %
:HMM:PFM   140->199 PF06823 * DUF1236 1.1e-20 51.7 60/65  
:HMM:PFM   32->83 PF08239 * SH3_3 6.9e-12 36.0 50/52  
:HMM:PFM   81->96 PF08141 * SspH 0.00083 37.5 16/58  
:BLT:SWISS 31->83 YRVJ_BACSU 4e-04 35.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87947.2 GT:GENE AAK87947.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2175098..2175697 GB:FROM 2175098 GB:TO 2175697 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87947.2 GB:DB_XREF GI:159140370 LENGTH 199 SQ:AASEQ MDKTLKMLIAGGAFALMAGYANAAMVATTASDISVRSGPGEDYPELGLATRGSNAVLDGCMEGSSWCRIEVNGLRGWAHADYLNVMYEGSPVILEQRRSDLSVPVVTYEKTASVQAEPNPGDPNLGRVGEVDPPQSVITYMDEHPAETVTYDGDIAVGSVLPADTRMVEVPDYQYRYVRVNDVPVLVEPSTRRIVYVYQ GT:EXON 1|1-199:0| BL:SWS:NREP 1 BL:SWS:REP 31->83|YRVJ_BACSU|4e-04|35.3|51/518| RP:PFM:NREP 1 RP:PFM:REP 143->197|PF06823|1e-05|50.9|55/64|DUF1236| HM:PFM:NREP 3 HM:PFM:REP 140->199|PF06823|1.1e-20|51.7|60/65|DUF1236| HM:PFM:REP 32->83|PF08239|6.9e-12|36.0|50/52|SH3_3| HM:PFM:REP 81->96|PF08141|0.00083|37.5|16/58|SspH| RP:SCP:NREP 1 RP:SCP:REP 22->87|1m9sA3|4e-07|19.7|66/86|b.34.11.1| OP:NHOMO 36 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1------------------1---------21--111-3122212311------1111-----------------------------------------------------------1----1-----11-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHHHHHHccccEEEEEcccEEEEcccccccEEEEEEccccEEEEEEEEccccEEEEEEccEEEEEEEEEEEEEEcccEEEcccccccccccccccccccccccccccccccccccEEcccccEEEEEEEEcccccEEEccEEEcccccccEEEEEEcccccEEEEEEccEEEEEcccccEEEEEEc //