[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87954.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  67/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   11->80 PF04380 * DUF526 9e-07 41.4 %
:HMM:PFM   11->80 PF04380 * DUF526 5.7e-28 44.3 70/70  
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87954.2 GT:GENE AAK87954.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2180677..2180940) GB:FROM 2180677 GB:TO 2180940 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87954.2 GB:DB_XREF GI:159140688 LENGTH 87 SQ:AASEQ MSTTGTNRFLDEFAKLMTDAAGAAQGVRKEAEAAFHAQADRWLNSLDVVRREEFDAVREMAIQARDENDALRARIETLEAKLSAAKD GT:EXON 1|1-87:0| COIL:NAA 37 COIL:NSEG 1 COIL:REGION 51->87| RP:PFM:NREP 1 RP:PFM:REP 11->80|PF04380|9e-07|41.4|70/70|DUF526| HM:PFM:NREP 1 HM:PFM:REP 11->80|PF04380|5.7e-28|44.3|70/70|DUF526| OP:NHOMO 67 OP:NHOMOORG 67 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111-11111111111-11-11-1-111111--11111111111-----------1-11-------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-8,84-88| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //