[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87959.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:247 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->29 PF08085 * Entericidin 0.00036 46.2 13/42  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87959.2 GT:GENE AAK87959.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2185367..2186110 GB:FROM 2185367 GB:TO 2186110 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87959.2 GB:DB_XREF GI:159140373 LENGTH 247 SQ:AASEQ MSRTGFPPFFPAIIVPVLVLALSGCNTTEALTPQVNVGHNNASQSTPVTQGDLDQMAAAADRAPAGAPATATSVPAYAPQNSLQAQAQAMSSGNQYGEPLSQTSNAAQPPAAPPSQQTASLAPASSANSIRFLPIIGAPVQAVTPLSRQLGAEARAKGLTIRASNDNSAENILKGYFSAFADGNKVNIVYVWDVLDANGVRLHRLQGQETVAAKGSDPWAAVTDRAMQDIAAKTLNDYTSWKHSQRG GT:EXON 1|1-247:0| SEG 6->11|fppffp| SEG 57->76|aaaadrapagapatatsvpa| SEG 101->127|sqtsnaaqppaappsqqtaslapassa| HM:PFM:NREP 1 HM:PFM:REP 17->29|PF08085|0.00036|46.2|13/42|Entericidin| OP:NHOMO 28 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------11-11111111111---------11--111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,44-59,63-64,67-129,152-162,206-216,245-248| PSIPRED ccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEEccccccHHHHHHHHHHHcHHHHHcccEEEEcccccHHHHEEEEEEEEEccccEEEEEEEEEEcccccEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccc //