[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87976.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  143/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:157 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->146 3exzC PDBj 3e-23 41.5 %
:RPS:PDB   8->157 2bi0A PDBj 1e-19 15.0 %
:RPS:SCOP  9->147 1q6wA  d.38.1.4 * 2e-32 27.0 %
:HMM:SCOP  7->145 2c2iA1 d.38.1.4 * 5.3e-30 36.2 %
:RPS:PFM   22->115 PF01575 * MaoC_dehydratas 8e-06 36.4 %
:HMM:PFM   22->113 PF01575 * MaoC_dehydratas 8.1e-15 30.0 90/123  
:BLT:SWISS 10->146 YDEM_BACSU 2e-13 29.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87976.2 GT:GENE AAK87976.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2206040..2206513 GB:FROM 2206040 GB:TO 2206513 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87976.2 GB:DB_XREF GI:159140384 LENGTH 157 SQ:AASEQ MVPVATYTYEDFAVGREFPLGPQSISAAQIIEFASEFDPQPMHLSEEAGRRSILGGLAASGWHTCSLLMRMMADSYISNSTSQGSPGIDYVDWKKPVLAGDTLSGKSIVLEQRPSASRPGIGLVKLRHELYNQRGILVSQGENTVMFLMGGDGGVAA GT:EXON 1|1-157:0| BL:SWS:NREP 1 BL:SWS:REP 10->146|YDEM_BACSU|2e-13|29.6|135/141| BL:PDB:NREP 1 BL:PDB:REP 10->146|3exzC|3e-23|41.5|135/142| RP:PDB:NREP 1 RP:PDB:REP 8->157|2bi0A|1e-19|15.0|147/327| RP:PFM:NREP 1 RP:PFM:REP 22->115|PF01575|8e-06|36.4|88/116|MaoC_dehydratas| HM:PFM:NREP 1 HM:PFM:REP 22->113|PF01575|8.1e-15|30.0|90/123|MaoC_dehydratas| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF01575|IPR002539| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01575|IPR002539| RP:SCP:NREP 1 RP:SCP:REP 9->147|1q6wA|2e-32|27.0|137/151|d.38.1.4| HM:SCP:REP 7->145|2c2iA1|5.3e-30|36.2|138/0|d.38.1.4|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 227 OP:NHOMOORG 152 OP:PATTERN -------1-------1--------1-11-1-1------------------------------------ ----1--------------------------------212---1-----------1------1---1---2------------------------------------------------------------------------------------------------------------------111-----1--------------------1-------------------1111-1--1111-1--11-------------------------------------------------------------------------------------------------------------------------------1-----1253332-3232222222221222-11211211343-2222322334222311---2------1--------1----211-------------------------------231-111221111112111111111111111111131--11211----1212--------11---------1-21----------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111--11------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 157 STR:RPRED 100.0 SQ:SECSTR ccccccccGGGccTTcEEcccccEccHHHHHHHHHHccccHHHHcHHHHHHHHcccccccHHHHHHHHHHHHTTTTcccTTccEEEEEEcEEccccccTTcEEEEEEEEEEEEEccccTTcccEEEEEEEEcTTccEEEEEEEEEEEccTTcccccc DISOP:02AL 1-2,4-4,152-158| PSIPRED ccccccccHHHcccccEEEEccEEccHHHHHHHHHHcccccEEccHHHHHHcccccccccHHHHHHHHHHHHHHHccccccEEEEEEEEEEEEccccccccEEEEEEEEEEEEEccccccEEEEEEEEEEEEccccEEEEEEEEEEEEEcccccccc //