[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87977.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  129/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:155 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   9->154 3exzC PDBj 2e-19 40.6 %
:RPS:PDB   9->155 2bi0A PDBj 3e-16 12.8 %
:RPS:SCOP  8->147 1q6wA  d.38.1.4 * 5e-27 28.7 %
:HMM:SCOP  9->151 2c2iA1 d.38.1.4 * 3.1e-22 35.6 %
:RPS:PFM   11->119 PF01575 * MaoC_dehydratas 1e-08 41.9 %
:HMM:PFM   10->110 PF01575 * MaoC_dehydratas 1.9e-11 30.7 88/123  
:HMM:PFM   129->149 PF07872 * DUF1659 0.00012 19.0 21/47  
:BLT:SWISS 1->127 YDEM_BACSU 4e-10 33.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87977.1 GT:GENE AAK87977.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2206510..2206977 GB:FROM 2206510 GB:TO 2206977 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87977.1 GB:DB_XREF GI:15157387 LENGTH 155 SQ:AASEQ MRLAELSPIGERVTLDTLHFSAEDIIRFARDFDPQPFHLDAEAARNSVFGGLCASGWHTGAGWMKSFLSHWAKEVKRLKLQGLEPPKLGPSPGFRELKWKKPVFAGDDVTYFVTLLDARPLESRPGIWLNITFNEGVNQSGETVLTFQSGVLEFD GT:EXON 1|1-155:0| BL:SWS:NREP 1 BL:SWS:REP 1->127|YDEM_BACSU|4e-10|33.9|115/141| BL:PDB:NREP 1 BL:PDB:REP 9->154|3exzC|2e-19|40.6|133/142| RP:PDB:NREP 1 RP:PDB:REP 9->155|2bi0A|3e-16|12.8|133/327| RP:PFM:NREP 1 RP:PFM:REP 11->119|PF01575|1e-08|41.9|93/116|MaoC_dehydratas| HM:PFM:NREP 2 HM:PFM:REP 10->110|PF01575|1.9e-11|30.7|88/123|MaoC_dehydratas| HM:PFM:REP 129->149|PF07872|0.00012|19.0|21/47|DUF1659| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF01575|IPR002539| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01575|IPR002539| RP:SCP:NREP 1 RP:SCP:REP 8->147|1q6wA|5e-27|28.7|129/151|d.38.1.4| HM:SCP:REP 9->151|2c2iA1|3.1e-22|35.6|132/0|d.38.1.4|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 186 OP:NHOMOORG 134 OP:PATTERN ------------------------1-11-1-1------------------------------------ ----1----------------------------------1--------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-1--1111-1--11-------------------------------------------------------------------------------------------------------------------------------------1133332-2222221222221222-11111211233-22222222222223-1---2------1--------1----211-------------------------------11--111121111111111111111111111111131--11211----1112--------11---------1-21----------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111--11------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 100.0 SQ:SECSTR HHHHHHccTTcEEcccccEccHHHHHHHHHHccccHHHHcHHHHHHHHcccccccHHHHHHHHHHHHTTTTccHHcccccHHHHTTTccEEEEEEcEEccccccTTcEEEEEEEEEEEEEccccTTcEEEEEEEEEEcTTccEEEEEEEEEEEcc PSIPRED ccHHHHcccccEEEEccEEEcHHHHHHHHHccccccEEccHHHHHHcccccEEEccHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEccEEEEEccccccccEEEEEEEEEEEEEccccccccEEEEEEEEEEccccEEEEEEEEEEEEc //