[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87990.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:88 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   46->67 PF10304 * DUF2411 0.00082 40.0 20/37  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87990.2 GT:GENE AAK87990.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2221017..2221283 GB:FROM 2221017 GB:TO 2221283 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK87990.2 GB:DB_XREF GI:159140393 LENGTH 88 SQ:AASEQ MITSNSMPISASPEGASQSIDTPELIDRLAAEMRATGDRELPHSFYVEQVKRTLAGKTVKRADNDEMPRTKIPAAGTSSVFQCWAMPE GT:EXON 1|1-88:0| HM:PFM:NREP 1 HM:PFM:REP 46->67|PF10304|0.00082|40.0|20/37|DUF2411| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111---1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-19| PSIPRED ccccccccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccHHccccccccccccccccccHHHHHHHcccc //