[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87991.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:61 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   4->55 PF06348 * DUF1059 4e-04 34.6 %
:HMM:PFM   1->56 PF06348 * DUF1059 2.5e-20 35.7 56/57  
:BLT:SWISS 18->56 SLAP2_CAEEL 5e-04 30.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87991.1 GT:GENE AAK87991.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2221397..2221582 GB:FROM 2221397 GB:TO 2221582 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87991.1 GB:DB_XREF GI:15157403 LENGTH 61 SQ:AASEQ MRLFECGTLVPGCAWHTRADDDAEVVRRTVDHMRSAHGETIIRENMIENIKSRIRDEANAA GT:EXON 1|1-61:0| BL:SWS:NREP 1 BL:SWS:REP 18->56|SLAP2_CAEEL|5e-04|30.8|39/927| RP:PFM:NREP 1 RP:PFM:REP 4->55|PF06348|4e-04|34.6|52/57|DUF1059| HM:PFM:NREP 1 HM:PFM:REP 1->56|PF06348|2.5e-20|35.7|56/57|DUF1059| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--111-111-1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 58-61| PSIPRED cccccccccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccc //