[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87994.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  125/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:209 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->206 2re3B PDBj 2e-37 55.5 %
:RPS:PDB   53->175 2cw8A PDBj 3e-05 20.7 %
:RPS:PFM   49->196 PF06938 * DUF1285 2e-38 61.4 %
:HMM:PFM   49->197 PF06938 * DUF1285 2e-57 54.1 148/148  
:BLT:SWISS 71->176 PYRG_AZOBR 3e-04 30.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87994.1 GT:GENE AAK87994.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2223491..2224120) GB:FROM 2223491 GB:TO 2224120 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87994.1 GB:DB_XREF GI:15157406 LENGTH 209 SQ:AASEQ MAAETINSADDAAGLAAMISRAAEQTGDAKRGPAPVERWNPPFCGDLDMEIRADGTWFYLGTPIGRAPLVRLFSTVLRKDEDGKTYLVTPVEKVGIRVVDAPFVAVEMKATAGEEDGEPLLTFRTNVGDVVEAGPEHPLRFEIFGENRELKPYILVRGRLEALVSRAVMYDLVALGEVVAVDGVEMFAVRSGGVIFPVMPAKELERLSQ GT:EXON 1|1-209:0| BL:SWS:NREP 1 BL:SWS:REP 71->176|PYRG_AZOBR|3e-04|30.6|98/544| BL:PDB:NREP 1 BL:PDB:REP 31->206|2re3B|2e-37|55.5|164/179| RP:PDB:NREP 1 RP:PDB:REP 53->175|2cw8A|3e-05|20.7|116/528| RP:PFM:NREP 1 RP:PFM:REP 49->196|PF06938|2e-38|61.4|145/146|DUF1285| HM:PFM:NREP 1 HM:PFM:REP 49->197|PF06938|2e-57|54.1|148/148|DUF1285| OP:NHOMO 126 OP:NHOMOORG 125 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-----111111111111111111111111-11111111111-1111111111111111111111111111111111111111111------------------------------1111--------------------------------------------------------------------------------------------------------------------------------------11-1111-----------------------------------------------------------------------------------------------------------------------1----------1111---------------11111111111-11111111111111111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 169 STR:RPRED 80.9 SQ:SECSTR ##############################cccccGGGccccEEEEEE#EEcTEEEEEEHHHHHHHHTGGGcEEETTEEEEEcccEEEEEEcTTTccEEEEEEEEEEEEEEc#EEEEEEEEEEEETTccEEEEETTcEEEEEEETTETTccTEEEEEccccEccccccEEEHHHHcEE##ETT##EEEEEETTEEEE#EEHHHHHH### DISOP:02AL 1-15, 22-30, 208-209| PSIPRED cccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccEEEEEccEEEEcccccccHHHHHHHHHHEEEcccccEEEEccEEEEEEEEEcccEEEEEEEEEccccccEEEEEEEcccccEEEEcccccEEEEEcccccccccEEEEccccEEEEccHHHHHHHHcccccccccEEEEEEEEccEEEEcccHHHHHHHcc //