[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88006.2
DDBJ      :             benzoate transport protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  217/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:392 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   249->357 1n2mF PDBj 3e-04 34.3 %
:RPS:PFM   6->385 PF03594 * BenE 2e-58 44.5 %
:HMM:PFM   4->384 PF03594 * BenE 5e-107 43.6 374/378  
:BLT:SWISS 9->389 YDCO_ECOLI 3e-56 36.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88006.2 GT:GENE AAK88006.2 GT:PRODUCT benzoate transport protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2238735..2239913) GB:FROM 2238735 GB:TO 2239913 GB:DIRECTION - GB:PRODUCT benzoate transport protein GB:PROTEIN_ID AAK88006.2 GB:DB_XREF GI:159140401 LENGTH 392 SQ:AASEQ MLKDFSVQSLFMGCLTAFVGFASSFAVILQGLKAVGATDFQAASGLMVLSVAMGLCAIILSVATRMPISMAWSTPGGALLATTGVIEGGFPAAVGGFVVCAILIIIAGLFRPLGRAVASIPAPLANAMLSGVIIGLCYAPIKAIGFNPALGLPIILAWIVVGAFRRLFAVPAALAAFVLVMIFGVDIPAGALDSVAQSLTPPMEWVTPTFSLHAVVSIALPLFIVTMASQNIPGIAVLKVNHYDPQPGPLFAASGFFSLLSAPFGGHAVNLAAITAAMCAGEDAHPDPKRRYWAAIIAGVGYIISGLLAGAVTAFVALAPPILIQAVAGLALVGAFSGSAVAAFKEPDTREAAAITFLITASGLSFAGVSGAFWGLIGGGLMMALQRVVKRG GT:EXON 1|1-392:0| BL:SWS:NREP 1 BL:SWS:REP 9->389|YDCO_ECOLI|3e-56|36.7|376/391| TM:NTM 10 TM:REGION 9->31| TM:REGION 42->64| TM:REGION 84->106| TM:REGION 119->141| TM:REGION 160->182| TM:REGION 214->236| TM:REGION 260->281| TM:REGION 295->317| TM:REGION 324->345| TM:REGION 359->381| SEG 88->99|ggfpaavggfvv| SEG 163->180|afrrlfavpaalaafvlv| BL:PDB:NREP 1 BL:PDB:REP 249->357|1n2mF|3e-04|34.3|102/153| RP:PFM:NREP 1 RP:PFM:REP 6->385|PF03594|2e-58|44.5|375/377|BenE| HM:PFM:NREP 1 HM:PFM:REP 4->384|PF03594|5e-107|43.6|374/378|BenE| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF03594|IPR004711| OP:NHOMO 264 OP:NHOMOORG 218 OP:PATTERN -------------------------------------------------------------------- ----1--1111--------------------------122--1------11-11---2----1---1--------------------------------------------------------------------------------------------------------------------2-2---------------------------------------------11---------------------------------------------------------------------------------------------------------------------------11------11-------1--------------11---1-1---111-111112----------1--111111111111-1------1111-11---------------1-----------------------------------222122222222111122111111112221211---1--111121--11-11----11------------11-------1----1------------------1--------------------------1-11--1111--1111---1111----1---------------11---111111111111--1112111-1-1111111-11111-1-1-1-1111-11111-11---------1---------------------------11---------------2222212-2-1-11113331133322111--------------11111-----1111111-11--------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 102 STR:RPRED 26.0 SQ:SECSTR ########################################################################################################################################################################################################################################################HHHHHHH##HHHHHTcTT##cEEEEcccEEcTTcEEcccccccTTcEEEEEEEEEEEccTTcEEEEEEEEEEE#ccTTccEEEE##EEEEcccHHHHHHHHHHHHHHHH################################### DISOP:02AL 392-393| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccccccccccHHHcccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccHHHccHHHHHHHHHHHHHHHHHHHHcc //