[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88010.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:85 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   25->68 PF03052 * Adeno_52K 0.00011 20.5 44/201  
:REPEAT 2|24->38|39->53
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88010.2 GT:GENE AAK88010.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2242707..2242964 GB:FROM 2242707 GB:TO 2242964 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88010.2 GB:DB_XREF GI:159140689 LENGTH 85 SQ:AASEQ MTRIFTAIATASLFSVLSFAGIAHADSMKTDTMKKDTMHSDMMKAETMKKDGMSMTSKKDCMHKAGMQKDKMKKADMMKACDTMK GT:EXON 1|1-85:0| NREPEAT 1 REPEAT 2|24->38|39->53| SEG 64->84|kagmqkdkmkkadmmkacdtm| HM:PFM:NREP 1 HM:PFM:REP 25->68|PF03052|0.00011|20.5|44/201|Adeno_52K| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,45-72,74-74,84-86| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccc //