[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88014.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:QUEF_AGRT5   RecName: Full=NADPH-dependent 7-cyano-7-deazaguanine reductase;         EC=1.7.1.13;AltName: Full=7-cyano-7-carbaguanine reductase;AltName: Full=PreQ(0) reductase;AltName: Full=NADPH-dependent nitrile oxidoreductase;

Homologs  Archaea  0/68 : Bacteria  339/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.96.1
:154 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   55->130 3bp1D PDBj 2e-05 34.7 %
:RPS:PDB   5->145 3bp1A PDBj 1e-35 23.4 %
:HMM:SCOP  24->147 1fb1A_ d.96.1.1 * 3.3e-27 30.3 %
:RPS:PFM   58->111 PF01227 * GTP_cyclohydroI 9e-05 38.9 %
:HMM:PFM   58->135 PF01227 * GTP_cyclohydroI 7e-19 26.9 78/86  
:BLT:SWISS 1->154 QUEF_AGRT5 3e-91 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88014.2 GT:GENE AAK88014.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2245350..2245814) GB:FROM 2245350 GB:TO 2245814 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88014.2 GB:DB_XREF GI:159140406 LENGTH 154 SQ:AASEQ MSVTDVSGLSQLGTKVDTPESPEKAVLEKVPNGNAGTDYVVRFTAPEFTSLCPMTGQPDFAHIVIDYIPGDFLVESKSLKLFLQSFRNHGAFHEDCSVYIAKRLVELLQPKWLRIGAYWYPRGGIPIDVFWQTGAAPEGVWLPDQGVAPYRGRG GT:EXON 1|1-154:0| SW:ID QUEF_AGRT5 SW:DE RecName: Full=NADPH-dependent 7-cyano-7-deazaguanine reductase; EC=1.7.1.13;AltName: Full=7-cyano-7-carbaguanine reductase;AltName: Full=PreQ(0) reductase;AltName: Full=NADPH-dependent nitrile oxidoreductase; SW:GN Name=queF; OrderedLocusNames=Atu2273; ORFNames=AGR_C_4128; SW:KW Complete proteome; Cytoplasm; NADP; Oxidoreductase;Queuosine biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->154|QUEF_AGRT5|3e-91|100.0|154/154| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0008616|"GO:queuosine biosynthetic process"|Queuosine biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 55->130|3bp1D|2e-05|34.7|72/252| RP:PDB:NREP 1 RP:PDB:REP 5->145|3bp1A|1e-35|23.4|137/251| RP:PFM:NREP 1 RP:PFM:REP 58->111|PF01227|9e-05|38.9|54/86|GTP_cyclohydroI| HM:PFM:NREP 1 HM:PFM:REP 58->135|PF01227|7e-19|26.9|78/86|GTP_cyclohydroI| HM:SCP:REP 24->147|1fb1A_|3.3e-27|30.3|122/196|d.96.1.1|1/1|Tetrahydrobiopterin biosynthesis enzymes-like| OP:NHOMO 342 OP:NHOMOORG 341 OP:PATTERN -------------------------------------------------------------------- 1111--------------------------------------1------------------------------------1-1-111111111-111-----------------------------11111111111---------11111111--1111111111111111111111111111--------1-1111111111111111111111111-111111------1111111111111111111111----------------------------------1111111111111----------------111----11--1------------------------1-------------1111---1111111-----211111111111111111111111-11111111111111111111111111-11--1-----1111111111111111--------------------------------11111---------------------------------------1------1----11111-11111111111--111-1----1111111---1----111111-1111-111111111-11111111111111--------------------------------11111------------------------------------------------------------------------------------------------------1----------------------------1--1111111-111111111------------------------1111111111-1-1111-111111----------------------------------------11-111-11 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 145 STR:RPRED 94.2 SQ:SECSTR GGGGEEEEGGGGTTccccccEEccccccccccccccGGGGTTcEEEEEEEEEEEEEccEEEEEEEEEEEEcEEEcHHHHHHHHHTTTTccccHHHHHHHHHHHHHHHHcccEEEEEEEEcccTTEEEEEEEEcccccccccccTc######### DISOP:02AL 1-4,149-149,151-155| PSIPRED cccccccccccccccccccccccHHHcEEccccccccEEEEEEEEcccEEcccccccccEEEEEEEEEcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccEEEEEEEEEcccccEEcEEEccccccccccccccccccccccc //