[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88028.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  216/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:173 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   47->127 PF03350 * UPF0114 3e-05 38.3 %
:HMM:PFM   11->126 PF03350 * UPF0114 6.2e-32 36.2 116/124  
:BLT:SWISS 4->165 Y2386_SERP5 2e-30 48.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88028.1 GT:GENE AAK88028.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2257789..2258310) GB:FROM 2257789 GB:TO 2258310 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88028.1 GB:DB_XREF GI:15157446 LENGTH 173 SQ:AASEQ MKSLELLVERIILSSRWLLVVFYLGLVAALAVYAFSFALKFLKVAKNVFIYDESDMILAMLGLIDAALVASLIVMVMISGYENFVSRFDEADDEVSFLGKLDSGSLKIKVASSIVAISSIHLLQIFLNASQYTDSQLMWFTIIHLAFVVSAVMLGFLEKLMAKPKDKSEKQVL GT:EXON 1|1-173:0| BL:SWS:NREP 1 BL:SWS:REP 4->165|Y2386_SERP5|2e-30|48.8|162/164| TM:NTM 4 TM:REGION 16->38| TM:REGION 59->81| TM:REGION 109->131| TM:REGION 138->160| SEG 18->35|llvvfylglvaalavyaf| SEG 107->120|kikvassivaissi| RP:PFM:NREP 1 RP:PFM:REP 47->127|PF03350|3e-05|38.3|81/124|UPF0114| HM:PFM:NREP 1 HM:PFM:REP 11->126|PF03350|6.2e-32|36.2|116/124|UPF0114| OP:NHOMO 227 OP:NHOMOORG 217 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-------22211121222----------1-11-1111-----111--1-111--11-----1---------------1----1-1-----------------------------------1111-1111112111111111111-11111111--11111111111-11-11111111-------111-11-------------------------------------------------------------1--1---11-111111-1111-1--1--1-------1---1-111-121111111111-111111111111111111111111--11-1111111111111111111111-----------------1-----1111--1--111----11111--1--------2-1111111111111111111--------------11111-----11----------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 161-173| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccEEEEEEEccHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHccccccEEEHHHHHHHHHHHHHHHHHHHHHHcccccccccccc //