Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88040.2
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:170 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88040.2 GT:GENE AAK88040.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2273418..2273930) GB:FROM 2273418 GB:TO 2273930 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK88040.2 GB:DB_XREF GI:159140420 LENGTH 170 SQ:AASEQ MIFDKSWKRRFASARAHLSLFAGLAAGFVYSLSLPWFPGVWPVVGYWVFAPAPFVALAVWFIILRGSRREMKSYYEALAHWNIAHERMYSPQIQVEIGPEGYKQVTRLDTVQLSWARYHLAITPPDSLVLVFHGTVAVIPSSALSMAPKDIVEKINQWSAAQQKELLPLS GT:EXON 1|1-170:0| TM:NTM 2 TM:REGION 16->38| TM:REGION 42->64| SEG 47->61|wvfapapfvalavwf| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,3-3,170-171| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHHccccEEEEEEcHHHHHHHHEEcEEEEEEEEEEEEEccccEEEEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHccccccc //