[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88041.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.3.1
:202 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->202 2hlyA PDBj e-115 100.0 %
:RPS:SCOP  1->202 2hlyA1  d.3.1.19 * 6e-12 96.0 %
:RPS:PFM   6->202 PF09641 * DUF2026 2e-63 61.7 %
:HMM:PFM   4->202 PF09641 * DUF2026 3.6e-95 58.6 198/204  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88041.1 GT:GENE AAK88041.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2274151..2274759) GB:FROM 2274151 GB:TO 2274759 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK88041.1 GB:DB_XREF GI:15157461 LENGTH 202 SQ:AASEQ MLIKQTDYFRIYRVINSLLISQNADPASASMYFSTFGAFILQQHYKVKAVPKGGLAAYNLGGTVLLFADHREDGYVTGAGENFHCWVEADGWAIDFMAPAFSEGTDALAVPAKMFQRPLSAMAASINDLGQSGDFFYRSEPEATARRFADWHKQAMIGDMASVAANWFRKSPKQMAASLSVTDRDGKARTVPLTGEMLTGAW GT:EXON 1|1-202:0| BL:PDB:NREP 1 BL:PDB:REP 1->202|2hlyA|e-115|100.0|200/205| RP:PFM:NREP 1 RP:PFM:REP 6->202|PF09641|2e-63|61.7|196/204|DUF2026| HM:PFM:NREP 1 HM:PFM:REP 4->202|PF09641|3.6e-95|58.6|198/204|DUF2026| RP:SCP:NREP 1 RP:SCP:REP 1->202|2hlyA1|6e-12|96.0|200/200|d.3.1.19| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 200 STR:RPRED 99.0 SQ:SECSTR ccccHHHHHHHHHHHHHHHGGGcccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEETTEEEEEccccc##ccccccTTcEEEEEETTEEEETTGGGTTTTcGGGccccccEEEEGGGccccTTccccTTcEEEEEcHHHHHHHTTTGGGcHHHHHHHHHHHHHcccTTcccccEEEEEcTTccEEEEEcccccccccc DISOP:02AL 202-203| PSIPRED cccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccccEEEEEEcccccEEEEccccEEEEEEEcccHHHHHHHccccccccEEccHHHHHHHHHHHHccHHHHcccccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccccEEEEccHHEEccc //