[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88044.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  85/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:194 amino acids
:PSIPRED
:RPS:PFM   22->187 PF07298 * NnrU 2e-19 45.1 %
:HMM:PFM   4->191 PF07298 * NnrU 1.1e-61 48.1 185/192  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88044.1 GT:GENE AAK88044.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2277359..2277943) GB:FROM 2277359 GB:TO 2277943 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88044.1 GB:DB_XREF GI:15157464 LENGTH 194 SQ:AASEQ MLFLVLCLALFLLTHLLKVVAPQFRARMIAAMGEGPFKGVYSLVSLITLGLVIYAFGEARQETGMLWNPPVFMSHIAVTLMLPAMICLIASLIPAGHIATKTKHPLILSVKIWALAHLLANGETSSILLFASFLAWGVVMRISLKRRERAGEKVVRDFVSSRYDLVAIVGGIVLWGAFILKLHEWLIGVQPIAM GT:EXON 1|1-194:0| TM:NTM 6 TM:REGION 1->23| TM:REGION 31->53| TM:REGION 71->93| TM:REGION 103->124| TM:REGION 126->144| TM:REGION 163->185| SEG 2->17|lflvlclalfllthll| RP:PFM:NREP 1 RP:PFM:REP 22->187|PF07298|2e-19|45.1|162/197|NnrU| HM:PFM:NREP 1 HM:PFM:REP 4->191|PF07298|1.1e-61|48.1|185/192|NnrU| OP:NHOMO 88 OP:NHOMOORG 85 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-----1111111111111------------111111111-1-111211211111111112--1111111---------11---------------------------------------------111111-111-11-11111-111----------11----111----------------------1------------------------------------------------------------11--------------------------1----1-1-------------------------------------------------------------------------------------------------------1---1--------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEcccccccccccccHHHHHHHHHccccccccHHHHHHHcHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccc //