[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88062.1
DDBJ      :             quaternary ammonium compound-resistance protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  239/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:114 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->114 1s7bB PDBj 1e-16 39.3 %
:RPS:SCOP  11->114 1s7bA  f.39.1.1 * 2e-04 39.4 %
:HMM:SCOP  9->114 1s7bA_ f.39.1.1 * 2.4e-15 28.3 %
:RPS:PFM   11->98 PF00893 * Multi_Drug_Res 5e-10 43.2 %
:HMM:PFM   8->98 PF00893 * Multi_Drug_Res 4.7e-28 46.2 91/93  
:BLT:SWISS 11->114 QACE_KLEAE 5e-20 43.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88062.1 GT:GENE AAK88062.1 GT:PRODUCT quaternary ammonium compound-resistance protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2297366..2297710) GB:FROM 2297366 GB:TO 2297710 GB:DIRECTION - GB:PRODUCT quaternary ammonium compound-resistance protein GB:PROTEIN_ID AAK88062.1 GB:DB_XREF GI:15157486 LENGTH 114 SQ:AASEQ MNAAVLTYGALVAAIVCEVIATSFLQQSQQFTRLLPTVLMALFYGAAFYLLSFTLRALPVGVAYAIWSGLGIVLISGIGYFVFRQTLDLAAVIGLGFIITGVVIVNVFSKTVGH GT:EXON 1|1-114:0| BL:SWS:NREP 1 BL:SWS:REP 11->114|QACE_KLEAE|5e-20|43.3|104/110| TM:NTM 4 TM:REGION 4->26| TM:REGION 32->54| TM:REGION 59->81| TM:REGION 88->110| SEG 66->79|iwsglgivlisgig| BL:PDB:NREP 1 BL:PDB:REP 8->114|1s7bB|1e-16|39.3|107/107| RP:PFM:NREP 1 RP:PFM:REP 11->98|PF00893|5e-10|43.2|88/93|Multi_Drug_Res| HM:PFM:NREP 1 HM:PFM:REP 8->98|PF00893|4.7e-28|46.2|91/93|Multi_Drug_Res| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF00893|IPR000390| RP:SCP:NREP 1 RP:SCP:REP 11->114|1s7bA|2e-04|39.4|104/106|f.39.1.1| HM:SCP:REP 9->114|1s7bA_|2.4e-15|28.3|106/106|f.39.1.1|1/1|Multidrug resistance efflux transporter EmrE| OP:NHOMO 268 OP:NHOMOORG 241 OP:PATTERN ------------------------1-------------------------1----------------- ---------------------------------------------------------1------------------------------------------11---------------------------1-11---11111----------------111--1------1---------------------1---------------------211-----1-------------------------------1------------------1----------------------------------------------------------------------------------------------------1-------------1----1111--11111111111-1---1-------111-1111111111-1-1-1111111122222222------11-----------------------------1--1-11111111111111111111-111111111111------1-1-11---------2-11-------------111-----1------------1--1----1----------------------------1111--1---111------1---------------1----------1111-11111122211-2-12--1-122111111111--1111211111211211111131---11111-1111111111111----1-------111-1-------------1-11215--111-1----1111111111111-----------11------1----11-1-1------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 107 STR:RPRED 93.9 SQ:SECSTR #######cHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHTccccccccccHHHHHHHHHHHHHTTTTTccccccccHHHHHHHHHHHHHHHHHHHHTTc DISOP:02AL 111-114| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccc //