[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88063.1
DDBJ      :             transcriptional regulator, TetR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  60/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:194 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->102 2hytA PDBj 2e-05 32.2 %
:RPS:PDB   15->186 3b81A PDBj 2e-09 13.6 %
:RPS:SCOP  19->87 1z77A1  a.4.1.9 * 8e-10 21.7 %
:RPS:SCOP  95->186 1v7bA2  a.121.1.1 * 2e-08 19.6 %
:HMM:SCOP  6->94 1t33A1 a.4.1.9 * 6.3e-16 35.2 %
:HMM:SCOP  93->190 1v7bA2 a.121.1.1 * 1e-22 29.6 %
:RPS:PFM   22->68 PF00440 * TetR_N 2e-04 40.4 %
:HMM:PFM   22->68 PF00440 * TetR_N 3.3e-19 51.1 47/47  
:BLT:SWISS 18->130 BETI_PSEMY 1e-05 32.1 %
:PROS 34->65|PS01081|HTH_TETR_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88063.1 GT:GENE AAK88063.1 GT:PRODUCT transcriptional regulator, TetR family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2297707..2298291) GB:FROM 2297707 GB:TO 2298291 GB:DIRECTION - GB:PRODUCT transcriptional regulator, TetR family GB:PROTEIN_ID AAK88063.1 GB:DB_XREF GI:15157487 LENGTH 194 SQ:AASEQ MFSLMTNAHERKKQPEIVRRNLLDCAAKLAAEQGVAALSVQAVADAAGVTKGGLFHHFSSKQVLLEAVMADLLSALDAEIDVLVSQDCEAFGRFTRAYVNAVFADRDRESGRQWAALSVSMIGEPSLRRMWTGWLEGRLARHKDTDDGVVLELVRLAADGIWFADLLADNGMAGGDRAALRARMIAQTKKEAGR GT:EXON 1|1-194:0| BL:SWS:NREP 1 BL:SWS:REP 18->130|BETI_PSEMY|1e-05|32.1|112/196| PROS 34->65|PS01081|HTH_TETR_1|PDOC00830| SEG 35->47|vaalsvqavadaa| BL:PDB:NREP 1 BL:PDB:REP 11->102|2hytA|2e-05|32.2|90/188| RP:PDB:NREP 1 RP:PDB:REP 15->186|3b81A|2e-09|13.6|169/181| RP:PFM:NREP 1 RP:PFM:REP 22->68|PF00440|2e-04|40.4|47/47|TetR_N| HM:PFM:NREP 1 HM:PFM:REP 22->68|PF00440|3.3e-19|51.1|47/47|TetR_N| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00440|IPR001647| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00440|IPR001647| RP:SCP:NREP 2 RP:SCP:REP 19->87|1z77A1|8e-10|21.7|69/75|a.4.1.9| RP:SCP:REP 95->186|1v7bA2|2e-08|19.6|92/101|a.121.1.1| HM:SCP:REP 6->94|1t33A1|6.3e-16|35.2|88/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 93->190|1v7bA2|1e-22|29.6|98/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 65 OP:NHOMOORG 60 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------1--------------------1-----------------1--------------------------------------------------------------------------------------------------------------------1------11--------11----1-------------------------1---1--------------------------------------------------------------------------------------------------------------1-----------------------1-----1-1--------------1---2-------111-11122211---------------11111111------------------------------------------------1111-11----11--------------1----------------------------------1----------1--------------------1------------------------------1-------------------------------------------1----------11------------1---------1-1-----1------------------------------------------------------------------------------11--------------------------------------------12----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 190 STR:RPRED 97.9 SQ:SECSTR ####HHTcccccccHHHHHHHHHHHHHHHHHHHccTTccHHHHHHHHTccHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHccTTccHHHHHHHHHHTccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccHccccHHHHHHHHHHHHHTTTcHHHHTccGGGHHHHHHHHHHHHHccccHHcc DISOP:02AL 1-21, 193-194| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcc //