[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88066.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  244/915 : Eukaryota  76/199 : Viruses  0/175   --->[See Alignment]
b.3.4
:118 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->118 2h0eB PDBj 1e-24 54.2 %
:RPS:PDB   4->114 3cfqB PDBj 7e-35 31.4 %
:RPS:SCOP  4->114 1bm7A  b.3.4.1 * 9e-23 32.4 %
:HMM:SCOP  1->120 1oo2A_ b.3.4.1 * 7.8e-40 52.6 %
:RPS:PFM   4->117 PF00576 * Transthyretin 2e-24 55.0 %
:HMM:PFM   3->117 PF00576 * Transthyretin 2.7e-43 50.9 110/112  
:BLT:SWISS 4->118 HIUH2_RHIME 1e-43 70.2 %
:PROS 7->22|PS00768|TRANSTHYRETIN_1
:PROS 101->113|PS00769|TRANSTHYRETIN_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88066.1 GT:GENE AAK88066.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2300503..2300859) GB:FROM 2300503 GB:TO 2300859 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88066.1 GB:DB_XREF GI:15157490 LENGTH 118 SQ:AASEQ MTGLTTHVLDAAHGVPAEGLTIELYRLSGDRREKLKTVKTNSDGRVDGGPLLVGDSFKAGEYELVFHAGDYLRGRGVQLAEPAFLDIIPIRFGIADESGHYHVPLLLSPYSYSTYRGS GT:EXON 1|1-118:0| BL:SWS:NREP 1 BL:SWS:REP 4->118|HIUH2_RHIME|1e-43|70.2|114/120| PROS 7->22|PS00768|TRANSTHYRETIN_1|PDOC00617| PROS 101->113|PS00769|TRANSTHYRETIN_2|PDOC00617| BL:PDB:NREP 1 BL:PDB:REP 4->118|2h0eB|1e-24|54.2|107/109| RP:PDB:NREP 1 RP:PDB:REP 4->114|3cfqB|7e-35|31.4|105/114| RP:PFM:NREP 1 RP:PFM:REP 4->117|PF00576|2e-24|55.0|109/112|Transthyretin| HM:PFM:NREP 1 HM:PFM:REP 3->117|PF00576|2.7e-43|50.9|110/112|Transthyretin| RP:SCP:NREP 1 RP:SCP:REP 4->114|1bm7A|9e-23|32.4|105/114|b.3.4.1| HM:SCP:REP 1->120|1oo2A_|7.8e-40|52.6|114/0|b.3.4.1|1/1|Transthyretin (synonym: prealbumin)| OP:NHOMO 383 OP:NHOMOORG 320 OP:PATTERN -------------------------------------------------------------------- --1-1---------1---------11-----11---1122--11--1-----1111------1-1-1---------------1----------------11----1------------------------------------------------------------------------------11-----------------------11---1-----------------1-----------------------------------------------------------------------------------------------------------------------------------------------111--------222--------11111111112-1122111411--1111-121112221---21111111121111111111111--------------------------------------1----1113111----11111111111113331--11111111111-3111------------------1------------------------------1-------1111---------------------1--1-1-----------------------------------1-1-121111111111-111111111111111111-222-----11111211111111121-1-1111-----------------------------121111-1----------2211212-1-1111111322111112111-------------1------------11111111------------------------------------------------------------1-- ----11------11-11---------1--------------------1--------------1---11-1---11-----11-1--11--211111111111-111-12-2222111-----2-21-1------------1---1-----1--1-1-11----1-1-11--13-1-1--A---1-1111-1111111-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 100.0 SQ:SECSTR cccEEEEEEETTTTEEccccEEEEEEEcTccEEEEEEEEccTTcEEcccccccTTTcccEEEEEEEcHHHHHHHTTcTTTcccccccEEEEEEEcccccEEEEEEEEETTEEEEEEcc DISOP:02AL 118-119| PSIPRED cccEEEEEEEccccEEccccEEEEEEccccccEEEEEEEEcccccccccccccccccccEEEEEEEEEHHHHHHccccccccccccEEEEEEEEEcccccEEEEEEEccccEEEEEcc //