[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88071.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  213/915 : Eukaryota  26/199 : Viruses  0/175   --->[See Alignment]
c.6.2
:307 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->302 3cl6A PDBj e-108 60.6 %
:RPS:PDB   5->302 3cl6A PDBj 7e-38 60.6 %
:RPS:SCOP  5->302 1z7aA1  c.6.2.6 * 3e-60 58.6 %
:HMM:SCOP  5->305 1z7aA1 c.6.2.6 * 6.8e-85 36.5 %
:RPS:PFM   109->181 PF01522 * Polysacc_deac_1 2e-07 39.7 %
:HMM:PFM   77->176 PF01522 * Polysacc_deac_1 3.1e-15 24.0 100/124  
:BLT:SWISS 7->302 CDA1_SCHPO 2e-68 44.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88071.1 GT:GENE AAK88071.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2302563..2303486) GB:FROM 2302563 GB:TO 2303486 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88071.1 GB:DB_XREF GI:15157497 LENGTH 307 SQ:AASEQ MISENYSRNLVGYGRNAPDPKWPGGARIAVQFVINYEEGGESCILDNDKASESLLSEIVGAQPWPGQRNLNMESIYEYGSRAGFWRLWRMFTGLGVTTTVYGVTAAMARNPEAVAAMKEAGWEIASHGYRWLEYKDFSEEEERKHIVEAVHLHTELTGERPYGMYQGKPSDNTLRLVMEEGGFLYSSDSYADDLPYWVKGVGDEPFLIIPYTLDTNDMRFATPQGFNSGDQFFTYLKDAFDVLYQEGVEGAPKMMSIGLHCRLVGRPGRAAALRRFIEYVLGHEKVWIPQRLEIARHWHEHHKPETP GT:EXON 1|1-307:0| BL:SWS:NREP 1 BL:SWS:REP 7->302|CDA1_SCHPO|2e-68|44.7|295/320| SEG 92->104|tglgvtttvygvt| BL:PDB:NREP 1 BL:PDB:REP 5->302|3cl6A|e-108|60.6|297/302| RP:PDB:NREP 1 RP:PDB:REP 5->302|3cl6A|7e-38|60.6|297/302| RP:PFM:NREP 1 RP:PFM:REP 109->181|PF01522|2e-07|39.7|73/123|Polysacc_deac_1| HM:PFM:NREP 1 HM:PFM:REP 77->176|PF01522|3.1e-15|24.0|100/124|Polysacc_deac_1| GO:PFM:NREP 2 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF01522|IPR002509| GO:PFM GO:0016810|"GO:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds"|PF01522|IPR002509| RP:SCP:NREP 1 RP:SCP:REP 5->302|1z7aA1|3e-60|58.6|297/301|c.6.2.6| HM:SCP:REP 5->305|1z7aA1|6.8e-85|36.5|299/0|c.6.2.6|1/1|Glycoside hydrolase/deacetylase| OP:NHOMO 337 OP:NHOMOORG 239 OP:PATTERN -------------------------------------------------------------------- ----1---------1---------14-----132321111--------------------------1--------------------------------------1---------------------------------------2--------1---------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--------124--------11111111111-2232212421--1111112221224122-23111114211111111111111---------------------------------------22--3222231222211232222221232251--11111111113-23-2-----1------------1--------------------------------------------------------------11----4----11----1----1--------------------11--1------------------------------111-1---11111111111111111-------1---2-12221111---------1111---11---------------1111111-1-1111112121111111111-------------1------------11111111--------------------------------------------------------------- ------------11-112-2-------------------------------1-1--1-----------------1-----------11----1-1----6--1-----1------------------------------------------------------1---------1---------------2--111111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 307 STR:RPRED 100.0 SQ:SECSTR cHHHcccccccTTTTcccccccGGGccEEEEEEEEEcTTccccGGGTcccccccccccTTcccccTcccHHHHHHHHHHHHTHHHHHHHHHHHTTcccEEEEcHHHHHHcHHHHHHHHHTTcEEEEccccccccTTccHHHHHHHHHHHHHHHHHHHcccccEEccccccTTHHHHHHHHccccEEcccccccccEEcccTTccccEEccccccccGGGGGcccccccHHHHHHHHHHHHHHHHHHTTTHccEEEEEEEEHHHHTcHHHHHHHHHHHHHHHTcccEEEccHHHHHHHHHHHcccccH DISOP:02AL 1-3, 305-307| PSIPRED ccccccccccccccccccccccccccEEEEEEEEEcccccccccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHHHccccEEEEEHHHHHHHHHHHHHHHHHcccEEEcccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHcccEEEEccccccccEEccccccccEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHHcccccc //