[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88072.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  71/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.61.1
:235 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  32->178 1fsiA  d.61.1.1 * 4e-14 12.1 %
:RPS:PFM   61->220 PF06299 * DUF1045 3e-32 51.2 %
:HMM:PFM   61->220 PF06299 * DUF1045 9.7e-61 51.9 160/160  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88072.1 GT:GENE AAK88072.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2303688..2304395) GB:FROM 2303688 GB:TO 2304395 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88072.1 GB:DB_XREF GI:15157498 LENGTH 235 SQ:AASEQ MRYAIHFTPSPNDPLTQAAAAWLGRDVYSGHAVEPPGTIDLGMQEISYHTALPRRYGFHGTIKAPFRLAEGQSEAALLRDLMYFSGRQDPFTLPQLVVARQENVFSLVPERPCEVLHFFAARVVQEFDHYRAPLSEAEIERADPDRLSASQLTNLHRWGSPHVMDEFRFQMSLTGGVDPSSSQRIERAVRKVFEPLLTRTLQFSSLALFIEDEPGAPFRVHSLHPMGRVSARKIA GT:EXON 1|1-235:0| RP:PFM:NREP 1 RP:PFM:REP 61->220|PF06299|3e-32|51.2|160/160|DUF1045| HM:PFM:NREP 1 HM:PFM:REP 61->220|PF06299|9.7e-61|51.9|160/160|DUF1045| RP:SCP:NREP 1 RP:SCP:REP 32->178|1fsiA|4e-14|12.1|141/179|d.61.1.1| OP:NHOMO 86 OP:NHOMOORG 71 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---1111111111111111---1--1--13--22222222222211---1111111111--------1---1-11-----------------------------------------------------11--------11111--11-----1---111-1-----1--------------------12-------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 138-149, 230-235| PSIPRED ccEEEEEccccccHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHcccccccccHHHccccccHHHHHHHHHHHHHccccccccccEEEEcccEEEEcccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHccccccHHHHHHHHHccccEEEcccEEEEEEcccccHHHHHHHHHHHHHHHHHHccccEEEccEEEEEEccccccEEEEEHHHcccccccccc //