[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88079.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  168/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.160.1
:205 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   160->202 1y7mA PDBj 1e-08 57.1 %
:RPS:SCOP  61->204 1y7mA1  b.160.1.1 * 9e-23 33.3 %
:HMM:SCOP  60->204 1y7mA1 b.160.1.1 * 8.9e-32 44.6 %
:RPS:PFM   66->201 PF03734 * YkuD 2e-07 37.2 %
:HMM:PFM   68->202 PF03734 * YkuD 4.8e-18 28.2 110/116  
:HMM:PFM   9->21 PF08139 * LPAM_1 0.00066 53.8 13/26  
:BLT:SWISS 65->203 YNHG_ECOLI 2e-15 36.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88079.1 GT:GENE AAK88079.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2313915..2314532) GB:FROM 2313915 GB:TO 2314532 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88079.1 GB:DB_XREF GI:15157507 LENGTH 205 SQ:AASEQ MSISRRGVLFGLPLFLAGCAHTGIGEQRLNYAAKPEEKFPLPAMHLDKVKPELRRQEVTYDTSHPAGTVVVDTPARRLYYVMGEGRAMRYGVGVGRQGLALKGDAYIGRKSEWPSWTPTANMMRRDPRNLKFAGGMPGGPNNPLGARALYLYRGGNDTMFRLHGTNQPQSIGHAMSSGCIRMLNHDIIDLYSRVPVGSRVVVLQA GT:EXON 1|1-205:0| BL:SWS:NREP 1 BL:SWS:REP 65->203|YNHG_ECOLI|2e-15|36.5|137/334| SEG 134->145|ggmpggpnnplg| BL:PDB:NREP 1 BL:PDB:REP 160->202|1y7mA|1e-08|57.1|42/161| RP:PFM:NREP 1 RP:PFM:REP 66->201|PF03734|2e-07|37.2|129/136|YkuD| HM:PFM:NREP 2 HM:PFM:REP 68->202|PF03734|4.8e-18|28.2|110/116|YkuD| HM:PFM:REP 9->21|PF08139|0.00066|53.8|13/26|LPAM_1| RP:SCP:NREP 1 RP:SCP:REP 61->204|1y7mA1|9e-23|33.3|114/116|b.160.1.1| HM:SCP:REP 60->204|1y7mA1|8.9e-32|44.6|112/0|b.160.1.1|1/1|L,D-transpeptidase catalytic domain-like| OP:NHOMO 679 OP:NHOMOORG 169 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------1-------------------------------1--------------11111-----------------------------------------------------------------------------------------------------------------------------------------11---1---------------1111168B9966788A9855554454548-ADAAE89A78--677598A9898867---A133434313--------------------------------------------------------------------------------------------------------------------------------------------------21----1----------------------------221---1----------1------------1-1-1-1------33221214444444444-444444444444444444433322--1443444444442424424344443111-1-11111111-------------1--1----------------------------------------------------------1--------------------------1-------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 42 STR:RPRED 20.5 SQ:SECSTR ###############################################################################################################################################################cEEEccccGGGTTcEEEcccEEc#HHHHHHHHHHccTTcEEEE### DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHccHHHHHEEccccccccccEEEEEccccEEEEEEcccEEEEEEEEEcccccccccEEEEEEEEEcccccccHHHHHHcccccccccEEccccccccccEEEEEEEcccccEEEEccccccccccEEccccEEEccHHHHHHHHHHcccccEEEEEEc //