[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88080.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  94/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:298 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  37->145 1s7bA_ f.39.1.1 * 1.2e-11 28.6 %
:HMM:SCOP  188->296 1s7bA_ f.39.1.1 * 1.3e-10 29.5 %
:HMM:PFM   13->137 PF00892 * EamA 2.9e-17 22.8 123/126  
:HMM:PFM   168->288 PF00892 * EamA 9.7e-15 20.8 120/126  
:BLT:SWISS 9->296 YVBV_BACSU 1e-08 27.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88080.2 GT:GENE AAK88080.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2314611..2315507) GB:FROM 2314611 GB:TO 2315507 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88080.2 GB:DB_XREF GI:159140433 LENGTH 298 SQ:AASEQ MSLDRLAPAIFVFLWSTGWVTAKYAVYYTGPLTFLCLRYLLAGLLLWAICRFSGISWPKQRADVLRAILSGVFLHGIYLGMIWWAIGQGVPAAIGGIIAGLQPLMTAVAARFMIGERISPLQRAGLLLGFAGIAIAVLPKVMATGALGMSVPLYAVAVNVLGMVSVTYGTLYQKKYVHGGNIMAVATLQYVGALLVTVPFALLLEDGHVDWSLGLAATLGWSVGAISIGAVALLLYLIRRGQVSRAASLIYLVPPLAAVEAAVLFGETLTPAMIAGTVLAVTGVYLANRKPAASVAVR GT:EXON 1|1-298:0| BL:SWS:NREP 1 BL:SWS:REP 9->296|YVBV_BACSU|1e-08|27.8|266/305| TM:NTM 9 TM:REGION 1->22| TM:REGION 32->54| TM:REGION 62->84| TM:REGION 92->114| TM:REGION 120->142| TM:REGION 147->168| TM:REGION 181->203| TM:REGION 216->238| TM:REGION 256->278| SEG 35->46|lclryllaglll| SEG 85->100|aigqgvpaaiggiiag| SEG 252->264|lvpplaaveaavl| HM:PFM:NREP 2 HM:PFM:REP 13->137|PF00892|2.9e-17|22.8|123/126|EamA| HM:PFM:REP 168->288|PF00892|9.7e-15|20.8|120/126|EamA| HM:SCP:REP 37->145|1s7bA_|1.2e-11|28.6|105/106|f.39.1.1|1/2|Multidrug resistance efflux transporter EmrE| HM:SCP:REP 188->296|1s7bA_|1.3e-10|29.5|105/106|f.39.1.1|2/2|Multidrug resistance efflux transporter EmrE| OP:NHOMO 99 OP:NHOMOORG 94 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-111111----------1-1111111111--111-11111111--1----1----1---------------1-1-----------------------------1---------11111111----2211------21-111111121111--11111-111----------------112----------------1----------------------------------------------1-1-------------------------------------------------------------------------------------------------1------------------------------------1-----------------------------11-1-1---111---------------1--1-----11111------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,293-299| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccccc //