[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88085.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:171 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   46->155 2a6aB PDBj 5e-09 9.7 %
:RPS:SCOP  70->153 1q2yA  d.108.1.1 * 4e-09 26.9 %
:HMM:SCOP  19->162 1m4iA_ d.108.1.1 * 1.8e-15 19.1 %
:HMM:PFM   74->151 PF00583 * Acetyltransf_1 5.1e-12 24.4 78/83  
:BLT:SWISS 71->152 AAC2_PROST 5e-04 29.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88085.1 GT:GENE AAK88085.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2319817..2320332 GB:FROM 2319817 GB:TO 2320332 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88085.1 GB:DB_XREF GI:15157513 LENGTH 171 SQ:AASEQ MYAPASTRSWQAGRERVLYRISDYRDCQSHGPTIAERVWTAWWQDSGLKVGDVAEHLQDMTNPHKLPTGFVAHDGDDYVGSAFLIHCDLEERPQYLPWVAALWVEEGRRRSGVARALMQAATQRAAELGHEASYLCCQRDLEAYYINCGWTVLERGVGKHDLTMLTFSTNI GT:EXON 1|1-171:0| BL:SWS:NREP 1 BL:SWS:REP 71->152|AAC2_PROST|5e-04|29.6|81/178| RP:PDB:NREP 1 RP:PDB:REP 46->155|2a6aB|5e-09|9.7|103/186| HM:PFM:NREP 1 HM:PFM:REP 74->151|PF00583|5.1e-12|24.4|78/83|Acetyltransf_1| RP:SCP:NREP 1 RP:SCP:REP 70->153|1q2yA|4e-09|26.9|78/140|d.108.1.1| HM:SCP:REP 19->162|1m4iA_|1.8e-15|19.1|131/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 25 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------1--------------11-------12------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------1----1--------------------1----------------------------------11-------------------1-----------------------------------------------------------------1----1-1------------------------------------1111111---------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 147 STR:RPRED 86.0 SQ:SECSTR ##############ccEEEEEccGGGHcccEHHHHHHHTcTTccHHHHHHHHHHTTTTccEEEEEHEEEHHHHHTccccEEEEEEEEEETTEEcccEEEEEEEEcccEEEEEEEEEEEHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHTcGGccTT########## DISOP:02AL 1-8| PSIPRED cccccccccccccccEEEEEHHHHcccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccEEEEEEEccEEEEEEEEEEEcccccccccEEEEEEEEcHHHHccHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHcccEEEEccccccccEEEEEEEcc //