[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88093.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:158 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88093.1 GT:GENE AAK88093.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2328053..2328529 GB:FROM 2328053 GB:TO 2328529 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88093.1 GB:DB_XREF GI:15157523 LENGTH 158 SQ:AASEQ MLFGQSVFQSVVERLKQEKEEEGTEPSPPAGHRIAGFSSGFVVDTHIEAPQPANGNLDAYLAFLADPAPPPESQTEPEPEPMPAHLEKTALADVSAELAIQETDTVATLAEKRRAFARLNHPDRVKPQFRHNATLRMTAANLLIDQALRMLRTREHFR GT:EXON 1|1-158:0| SEG 67->83|papppesqtepepepmp| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 15-30, 69-83, 153-158| PSIPRED cccHHHHHHHHHHHHHHHHHHHccccccccccEEEEcccccccccccccccccccHHHHHHHHHHcccccHHHHHcccccccHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //