[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88094.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   18->65 PF03073 * TspO_MBR 7.2e-05 16.7 48/144  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88094.1 GT:GENE AAK88094.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2328585..2328848) GB:FROM 2328585 GB:TO 2328848 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88094.1 GB:DB_XREF GI:15157524 LENGTH 87 SQ:AASEQ MLNIDTSHPLYRPLWVRLLIVGFCAAWAVIEFVNREFFWGTIVGGVGAYAAYELLLKFKPASNAAVSKDGAEEPAAESAPTDKNDAG GT:EXON 1|1-87:0| TM:NTM 2 TM:REGION 11->33| TM:REGION 36->57| HM:PFM:NREP 1 HM:PFM:REP 18->65|PF03073|7.2e-05|16.7|48/144|TspO_MBR| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--111-11111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 62-87| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccc //