[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88103.1
DDBJ      :             ABC transporter, membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  686/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:229 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->153 3dhwA PDBj 2e-10 36.2 %
:RPS:PDB   123->160 3dhwA PDBj 2e-08 41.2 %
:RPS:SCOP  1->223 2r6gG1  f.58.1.1 * 5e-17 15.0 %
:HMM:PFM   35->223 PF00528 * BPD_transp_1 1e-13 18.9 175/185  
:BLT:SWISS 13->229 OCCM_RHIME 6e-45 45.5 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88103.1 GT:GENE AAK88103.1 GT:PRODUCT ABC transporter, membrane spanning protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2338450..2339139) GB:FROM 2338450 GB:TO 2339139 GB:DIRECTION - GB:PRODUCT ABC transporter, membrane spanning protein GB:PROTEIN_ID AAK88103.1 GB:DB_XREF GI:15157535 LENGTH 229 SQ:AASEQ MDFSWVAKYWPLLLSGAWQTLALLVISVSIGFVLAIGLAFAQVSGGRVTKILARAYCTFFRGTPLLIQLWLLYYGVGSFLPMIPGLRQSFMWPVLREGFFFAAVSFTLNYAAYEAEVLRGALLAVPKGELEAGRAFGMGRFTLIRRIWLPRAIRIALPTITGEVVMQLKATPLAFTVTVMDLYAVAYKVRQDTLLVYEPLIVVTVFYLILTAIIARCFGLVERQVPVRR GT:EXON 1|1-229:0| BL:SWS:NREP 1 BL:SWS:REP 13->229|OCCM_RHIME|6e-45|45.5|213/245| TM:NTM 4 TM:REGION 18->40| TM:REGION 58->80| TM:REGION 92->114| TM:REGION 199->221| BL:PDB:NREP 1 BL:PDB:REP 12->153|3dhwA|2e-10|36.2|127/203| RP:PDB:NREP 1 RP:PDB:REP 123->160|3dhwA|2e-08|41.2|34/203| HM:PFM:NREP 1 HM:PFM:REP 35->223|PF00528|1e-13|18.9|175/185|BPD_transp_1| RP:SCP:NREP 1 RP:SCP:REP 1->223|2r6gG1|5e-17|15.0|214/284|f.58.1.1| OP:NHOMO 4262 OP:NHOMOORG 720 OP:PATTERN 11--12----------1-1111114--21-2211----1122--2222--1-1----2------2--- ----43133333214------5---B------644424B713125172311-749125--21215678572544432221321---------------------------11111111111111-----1--4---12244111--22332233322---11--1--3322--121---212-1341111--264555557755665566233875562237543555553952222222222222222222467459B675676655B93746B433388876665AA888777888876666566666666767A98777713557564545523234442333212214233199-4132-1111111171--11124443421K67122412212364336456Q-22G22D27CI23iSSPSURRReHJK9---25J656835A1111111133411-46----------111111111111111--1-4--21-4EC9ENLLKNKB9CCDEEITEDEEADGGX77A4-186C8575498DFLP234----944422222---24--1J-897C56AAAA32-23-3-------1--5-3341445543222222222-13----99A-3-----A-1111--11111111-11-2---1--------AALL8BCAAAAAA8AA9-AACAAAAAAAAAA9AA99BIMGMK776A8A7AAAAAAAAAA8AG99899992-CAAAAAA9BAAA--4-222221111--69C55543533323333244444-54553-FDDFHPIR9GHCD5KHI----------6668888889997711---------------2----------------3-------------------------132-115111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------2----1------1-----------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 133 STR:RPRED 58.1 SQ:SECSTR ###########HHHHHHHHHHHHHHHHHHHHHHGGGGGGGGGGTTcccccc#ccHHHHHHHHccHHHHHHHH#####HHHHHTTcccc#########cHHHHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHH#HHHHHH##################################################################### DISOP:02AL 229-230| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //