[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88104.1
DDBJ      :             ABC transporter, membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  225/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:240 amino acids
:PSIPRED
:DISOPRED
:RPS:PDB   130->155 3dhwA PDBj 1e-08 46.2 %
:RPS:SCOP  120->235 2r6gG1  f.58.1.1 * 5e-09 12.9 %
:HMM:PFM   40->234 PF00528 * BPD_transp_1 3.2e-23 27.6 181/185  
:BLT:SWISS 17->235 HISQ_ECOLI 1e-23 39.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88104.1 GT:GENE AAK88104.1 GT:PRODUCT ABC transporter, membrane spanning protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2339151..2339873) GB:FROM 2339151 GB:TO 2339873 GB:DIRECTION - GB:PRODUCT ABC transporter, membrane spanning protein GB:PROTEIN_ID AAK88104.1 GB:DB_XREF GI:15157536 LENGTH 240 SQ:AASEQ MASLETTLQLLSPYPPGWGGTLLKGAASTLAISAGAYLIGIVIGLAGALGKLSGNRPLGLLLNLYTTAIRAVPELILIVGLYYAGTDGLNRLLQLMGLPPLEVNGFVAAVAVLGFVQGAYMTEVLRGAILAVPNGQIEAARAFGMSPFLRFRRVVLPALLPNALPGLANLWLAVTKDSALVAVVGYQELALATRLAGASTKQYFLFFLAAAFLYLAITLVSNLVFSQLERRVRRGQPALA GT:EXON 1|1-240:0| BL:SWS:NREP 1 BL:SWS:REP 17->235|HISQ_ECOLI|1e-23|39.3|219/228| TM:NTM 5 TM:REGION 28->50| TM:REGION 60->82| TM:REGION 94->116| TM:REGION 154->176| TM:REGION 204->226| SEG 34->52|agayligiviglagalgkl| SEG 105->119|gfvaavavlgfvqga| SEG 156->173|lpallpnalpglanlwla| SEG 203->216|yflfflaaaflyla| RP:PDB:NREP 1 RP:PDB:REP 130->155|3dhwA|1e-08|46.2|26/203| HM:PFM:NREP 1 HM:PFM:REP 40->234|PF00528|3.2e-23|27.6|181/185|BPD_transp_1| RP:SCP:NREP 1 RP:SCP:REP 120->235|2r6gG1|5e-09|12.9|116/284|f.58.1.1| OP:NHOMO 423 OP:NHOMOORG 225 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------1----------------------------------------------------------------------------------------------------------1---------------1--111-------------11------------------------------------1-------------------------------------------------------------------11111111111-------------1---------1-----------------------------------------1--11------------------------------1---1-112---1--1--12--444543444432-------------11--------------11-----------------------------1----------766676312223333323323453----------1------1-2-------2----------------2-11-11--331-----------------------------------------------3-2-----1--------------------------------2223122111111-111-111111111111111111123233--1222222222222222231111111--322222122222----11111------122---11111111111-11111--111--33234634323221323----------11112222222222------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 235-240| PSIPRED ccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //