[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88108.2
DDBJ      :             Hypothetical Protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:382 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->65 3cxqA PDBj 2e-04 12.3 %
:RPS:SCOP  206->283 1iicA2  d.108.1.2 * 4e-04 23.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88108.2 GT:GENE AAK88108.2 GT:PRODUCT Hypothetical Protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2342176..2343324 GB:FROM 2342176 GB:TO 2343324 GB:DIRECTION + GB:PRODUCT Hypothetical Protein GB:PROTEIN_ID AAK88108.2 GB:DB_XREF GI:159140444 LENGTH 382 SQ:AASEQ MHTHSGNGNSDQSTQRPVQLSATGIRPMRRDDLPAVEAVLNSAFKKTGQERNFDFRSYIERLFFGSPVFSPENGSVVYDTGERVTSVILAIPMRFVVHGKTITARLLCAFASDGKLGALGAARLSRGMRASKHDLLFSDTASPVSADHWVAIGGNMLPIESLQWHKALKPFCTIALRMPRRSKLAKTTLALTALGFVDGILRRWKKGLRPHEVAGARVRTVDCETFRREALAKIERFSIRPEWSHEEFHWLVKMSRANESLGELKSLVIENAEGHVMGAALFFGQRGRTAYVLNLVCDAGRENDVLNTLFCHFDDENYAHITGMSQPFLINALYRQNHMSFRHDGYFCMATRDDALREKALAGDIYIGGLCSESWSKLITDY GT:EXON 1|1-382:0| SEG 183->194|klakttlaltal| RP:PDB:NREP 1 RP:PDB:REP 1->65|3cxqA|2e-04|12.3|65/182| RP:SCP:NREP 1 RP:SCP:REP 206->283|1iicA2|4e-04|23.2|69/237|d.108.1.2| OP:NHOMO 13 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1---------21---11---2---22------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 132 STR:RPRED 34.6 SQ:SECSTR ccGGGcccccccccccccccTTEEEEEccGGGGGTTHHHHHTTTcccccccHHHHHHHHHHHHHHEEHHHHTccEEEEEETTEEEEEEEEEEcc#ccGGGTTEEEEEEEEcGGGTTccHHHHHHHHHHHHHHH######################################################################################################################################################################################################################################################### DISOP:02AL 1-17,212-215| PSIPRED cccccccccccccccccEEEEccccccccHHHcHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccccccccccccccEEEEEEEEEEEEccEEEEHHHHHHHHHcccccccHHHHHHHHHHcccccEEEcccccHHcHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccccccccEEEEcccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccHHHccHHHHEEEcccccHHHHHHHHcccccEEEEEEEHHccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHccccEEEEEccEEEEEEccHHHHHHHHcccEEEEcHHccHHHHHHHcc //