[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88117.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  245/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.1.1
:133 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->127 2bkmA PDBj 1e-23 45.8 %
:RPS:PDB   7->127 1dlwA PDBj 4e-21 24.3 %
:RPS:SCOP  7->130 1dlyA  a.1.1.1 * 2e-15 16.7 %
:HMM:SCOP  7->128 1ux8A_ a.1.1.1 * 5.5e-34 37.8 %
:RPS:PFM   8->124 PF01152 * Bac_globin 7e-15 40.9 %
:HMM:PFM   7->127 PF01152 * Bac_globin 1.5e-45 42.0 119/120  
:BLT:SWISS 9->128 YJBI_BACSU 2e-21 44.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88117.2 GT:GENE AAK88117.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2352777..2353178 GB:FROM 2352777 GB:TO 2353178 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88117.2 GB:DB_XREF GI:159140451 LENGTH 133 SQ:AASEQ MSSETVTLYEAIGGDATVRALTRRFYELMDTLPEAARCRAIHPADLSGSEAKFYDYLTGYLGGPPVYVEKHGHPMLRRRHFVAPIGPAERDEWLLCFRRAMDETIENAKLREIIWAPVERLAFHMQNQEADNP GT:EXON 1|1-133:0| BL:SWS:NREP 1 BL:SWS:REP 9->128|YJBI_BACSU|2e-21|44.0|116/132| BL:PDB:NREP 1 BL:PDB:REP 7->127|2bkmA|1e-23|45.8|118/128| RP:PDB:NREP 1 RP:PDB:REP 7->127|1dlwA|4e-21|24.3|115/116| RP:PFM:NREP 1 RP:PFM:REP 8->124|PF01152|7e-15|40.9|115/120|Bac_globin| HM:PFM:NREP 1 HM:PFM:REP 7->127|PF01152|1.5e-45|42.0|119/120|Bac_globin| GO:PFM:NREP 2 GO:PFM GO:0015671|"GO:oxygen transport"|PF01152|IPR001486| GO:PFM GO:0019825|"GO:oxygen binding"|PF01152|IPR001486| RP:SCP:NREP 1 RP:SCP:REP 7->130|1dlyA|2e-15|16.7|120/121|a.1.1.1| HM:SCP:REP 7->128|1ux8A_|5.5e-34|37.8|119/0|a.1.1.1|1/1|Globin-like| OP:NHOMO 254 OP:NHOMOORG 245 OP:PATTERN -------------------------------------------------------------------- ----11111111-111111-11111111111111111111111111111111111111--111-1111111-----------------------------------11----------------------------11111------------------------------------------111-----11111111111111111111111111111111--------1111111111111111111111------------------------------------------------------------------------------------------------------------------------1-----------12122--------------------------------11111111111111----------1-1-----------------------------------------------2---111111111111111111111111111221111-111111-1112111-111111111---------1-111---------------------------11---------------------------11---1-1---211111111-111111111-2------1------------------------------------------------------------------------------------------------------1--1--------------------------1-----1---1----1----------------1----------------------------11--11------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 127 STR:RPRED 95.5 SQ:SECSTR ###ccccHHHHTTcHHHHHHHHHHHHHHHHTcTTTGGGGTTccccHHHHHHHHHHHHHHHTTccccccHHccccHHHHHHTTccccHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHTTHHHHccccc### DISOP:02AL 1-4,126-126,129-134| PSIPRED cccccccHHHHHccHHHHHHHHHHHHHHHHHcHHHHHHHccccccHHHHHHHHHHHHHHHcccccHHHHHcccHHHHHccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccc //