[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88120.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:141 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   36->129 PF10087 * DUF2325 3e-13 36.6 %
:HMM:PFM   36->129 PF10087 * DUF2325 1.9e-28 34.0 94/98  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88120.2 GT:GENE AAK88120.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2353818..2354243) GB:FROM 2353818 GB:TO 2354243 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88120.2 GB:DB_XREF GI:159140452 LENGTH 141 SQ:AASEQ MARKEKKKAERGGKQGKGAPQPERDVAEQQLSGPKSFLYVGGRDCQVAHLRQIASNFGAELIHHDGGLREAVSRIDTVLPSVDCVFCPIDCISHDACLRVKSGCKKFGKTFIPLRNGSKSSLERALQTMNERTPNDERRAQ GT:EXON 1|1-141:0| SEG 2->19|arkekkkaerggkqgkga| RP:PFM:NREP 1 RP:PFM:REP 36->129|PF10087|3e-13|36.6|93/95|DUF2325| HM:PFM:NREP 1 HM:PFM:REP 36->129|PF10087|1.9e-28|34.0|94/98|DUF2325| OP:NHOMO 27 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------1-----1-----111111111111----------------------------2-1-------------------------------------------1-----------------1------------------------1-------------11--------1----1-----------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-31,130-142| PSIPRED ccccccccHHHcccccccccccccccHHHHHccccEEEEEcccccHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHccEEEEEcccccHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHccccHHHHcc //