[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88121.1
DDBJ      :             transcriptional regulator, TetR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  208/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:213 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->210 1pb6A PDBj 9e-50 49.4 %
:RPS:PDB   21->209 3dewA PDBj 2e-24 19.1 %
:RPS:SCOP  1->90 1t33A1  a.4.1.9 * 2e-16 28.9 %
:RPS:SCOP  87->210 1pb6A2  a.121.1.1 * 2e-18 47.6 %
:HMM:SCOP  7->95 1t33A1 a.4.1.9 * 3e-18 38.6 %
:HMM:SCOP  87->212 1pb6A2 a.121.1.1 * 1.1e-46 50.8 %
:RPS:PFM   23->69 PF00440 * TetR_N 3e-06 42.6 %
:RPS:PFM   70->208 PF08362 * TetR_C_3 2e-45 59.7 %
:HMM:PFM   70->210 PF08362 * TetR_C_3 2.1e-62 54.6 141/143  
:HMM:PFM   23->68 PF00440 * TetR_N 1.3e-17 39.1 46/47  
:BLT:SWISS 31->210 RUTR_ECO57 2e-49 49.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88121.1 GT:GENE AAK88121.1 GT:PRODUCT transcriptional regulator, TetR family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2354405..2355046) GB:FROM 2354405 GB:TO 2355046 GB:DIRECTION - GB:PRODUCT transcriptional regulator, TetR family GB:PROTEIN_ID AAK88121.1 GB:DB_XREF GI:15157555 LENGTH 213 SQ:AASEQ MAIPRAAKTQKRTRIQEEKQETILEAALSVFSTNGFRGSTIDQIAEAAGMSKPNVLYYFRTKEAMHRALIERVLDTWLDPLRAFDAEGNPESEIRSYIRRKLEMSRDFPRESRLFANEILQGAPHIEDELKGPLKQLVDEKAEVIRAWIKAGRMAKCDPYHLIFSIWSTTQHYADFDVQVRAVLGDKHGGDGRFEDAARHLEQLFMGGLRISG GT:EXON 1|1-213:0| BL:SWS:NREP 1 BL:SWS:REP 31->210|RUTR_ECO57|2e-49|49.4|180/212| BL:PDB:NREP 1 BL:PDB:REP 31->210|1pb6A|9e-50|49.4|180/198| RP:PDB:NREP 1 RP:PDB:REP 21->209|3dewA|2e-24|19.1|183/186| RP:PFM:NREP 2 RP:PFM:REP 23->69|PF00440|3e-06|42.6|47/47|TetR_N| RP:PFM:REP 70->208|PF08362|2e-45|59.7|139/143|TetR_C_3| HM:PFM:NREP 2 HM:PFM:REP 70->210|PF08362|2.1e-62|54.6|141/143|TetR_C_3| HM:PFM:REP 23->68|PF00440|1.3e-17|39.1|46/47|TetR_N| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00440|IPR001647| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00440|IPR001647| GO:PFM GO:0016481|"GO:negative regulation of transcription"|PF08362|IPR013573| GO:PFM GO:0016564|"GO:transcription repressor activity"|PF08362|IPR013573| RP:SCP:NREP 2 RP:SCP:REP 1->90|1t33A1|2e-16|28.9|83/88|a.4.1.9| RP:SCP:REP 87->210|1pb6A2|2e-18|47.6|124/126|a.121.1.1| HM:SCP:REP 7->95|1t33A1|3e-18|38.6|88/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 87->212|1pb6A2|1.1e-46|50.8|126/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 278 OP:NHOMOORG 209 OP:PATTERN -------------------------------------------------------------------- -1------------1----------------------1-2------------1--1---------11-1---------------------------------------1----------------------------------1----1-------------------11----------------------------------------------------1---------1--------------------------------------------------------------------------------------------------------------111-------------1-----------------11--------2-1--------11121-11113-11-1111-11--1111112111111----111223311111111111------------------------------------------------122121-111-11111111-14111111----1--1--111-51-----------------------1-1---------------------------1-----------------------11-----2--3-2--------1---------------1---------111--111111111111-1111111111111-11111111-----11-111111111111111111111--1--------------------------112---------------111111111-1144444453224333333-------------1---------------------------------------------------------------------------------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 207 STR:RPRED 97.2 SQ:SECSTR ###cTcTcccccccccTHHHHHHHHHHHHHHHHHcGGGccHHHHHHHHTccHHHHHHHccHHHHHHHHHHHHHHGGGGccHHHcHTTTTcHHHHHHHHHHHHHHHHHcTTHHHHHHHHHHcccHHHHHTHHHHHHHHHHHHHHHHHHHHHTcccTTccHHHHHHHHHHHHHHHHHHHHTGGGcTTTccccGGGHHHHHHHHHHHHHHccc### DISOP:02AL 1-22| PSIPRED cccccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccc //