[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88142.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  80/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:85 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   3->58 PF06906 * DUF1272 3e-14 76.4 %
:HMM:PFM   1->58 PF06906 * DUF1272 2.4e-33 75.4 57/57  
:BLT:SWISS 3->85 Y2474_RHIME 1e-33 73.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88142.1 GT:GENE AAK88142.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2376492..2376749) GB:FROM 2376492 GB:TO 2376749 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88142.1 GB:DB_XREF GI:15157580 LENGTH 85 SQ:AASEQ MALELRPNCECCDRDLAPHSRDAMICSFECTFCADCASDVLHGACPNCGGELVRRPVRPAAKLVNNPASTRRVLKAEGCAAATAA GT:EXON 1|1-85:0| BL:SWS:NREP 1 BL:SWS:REP 3->85|Y2474_RHIME|1e-33|73.5|83/84| RP:PFM:NREP 1 RP:PFM:REP 3->58|PF06906|3e-14|76.4|55/56|DUF1272| HM:PFM:NREP 1 HM:PFM:REP 1->58|PF06906|2.4e-33|75.4|57/57|DUF1272| OP:NHOMO 80 OP:NHOMOORG 80 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------1-----------------------------------------------------------------------------------------------1--------------------------------------------11-1111-1111111--------1--------------------------------------------------------------------------------------------------------------------------------------------------------------1111-------111-----------------------------11--111111-1111---1--1------------------------------------------------------11-1------1111111----1111------1-11-1-----1-1---111-----1-------------------------------------------------------------------------------1------1------------------------------------11----------------------------------1-11--------------------------------------------1-------------1---------------------------11111---11111----------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 82-85| PSIPRED ccEEcccccccccccccccccccEEEEEEcccccHHHHHHHcccccccccccccccccHHHHHcccccccEEEEccccccccccc //