[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88148.2
DDBJ      :             ABC transporter, nucleotide binding/ATPase protein (urea/amide)
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  192/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:253 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   9->252 1g9xA PDBj 2e-33 35.4 %
:RPS:PDB   12->252 2d3wB PDBj 9e-37 24.1 %
:RPS:SCOP  11->252 1b0uA  c.37.1.12 * 3e-38 26.1 %
:HMM:SCOP  12->252 1g6hA_ c.37.1.12 * 1e-52 33.3 %
:RPS:PFM   52->183 PF00005 * ABC_tran 5e-10 32.5 %
:HMM:PFM   52->182 PF00005 * ABC_tran 1.5e-24 34.5 116/118  
:HMM:PFM   231->252 PF12399 * BCA_ABC_TP_C 6e-07 59.1 22/23  
:HMM:PFM   20->69 PF03193 * DUF258 2.4e-05 18.4 49/161  
:BLT:SWISS 12->252 LIVG_ARCFU 9e-36 36.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88148.2 GT:GENE AAK88148.2 GT:PRODUCT ABC transporter, nucleotide binding/ATPase protein (urea/amide) GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2380326..2381087) GB:FROM 2380326 GB:TO 2381087 GB:DIRECTION - GB:PRODUCT ABC transporter, nucleotide binding/ATPase protein (urea/amide) GB:PROTEIN_ID AAK88148.2 GB:DB_XREF GI:159140468 LENGTH 253 SQ:AASEQ MNTVSENRTKSLLYLDGVSVSFDGFKALNSLSFVVEPGELRAIIGPNGAGKTTMMDIITGKTRPDTGTVLFEDSIDLTKKDEADIAQLGIGRKFQKPTVFESHTVWDNLELALNRKRGVFATLFYRLTEEDKARIEEILATVRLGHRRGDLAANLSHGQKQWLEIGMLLAQEPKLLLVDEPVAGMTDAETAETTVLLKEIAKTRSVVVVEHDMGFIRELGVKVTCLAEGSVLAEGSIDFVSSDPKVIENYLGR GT:EXON 1|1-253:0| BL:SWS:NREP 1 BL:SWS:REP 12->252|LIVG_ARCFU|9e-36|36.7|240/257| BL:PDB:NREP 1 BL:PDB:REP 9->252|1g9xA|2e-33|35.4|243/253| RP:PDB:NREP 1 RP:PDB:REP 12->252|2d3wB|9e-37|24.1|241/244| RP:PFM:NREP 1 RP:PFM:REP 52->183|PF00005|5e-10|32.5|123/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 52->182|PF00005|1.5e-24|34.5|116/118|ABC_tran| HM:PFM:REP 231->252|PF12399|6e-07|59.1|22/23|BCA_ABC_TP_C| HM:PFM:REP 20->69|PF03193|2.4e-05|18.4|49/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 11->252|1b0uA|3e-38|26.1|234/258|c.37.1.12| HM:SCP:REP 12->252|1g6hA_|1e-52|33.3|240/254|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 37897 OP:NHOMOORG 1168 OP:PATTERN MMG6KJEDLLKIKGNGdEMKJKJVqIMYjLdUFAEDD9GEFCBRaKTdJM*od7KYKNSJIHGCQ168 NRgJ*TSVddfQPNMKLKJ-JW77S*KKKKKLiYYZb***QuO*fifRfaUKsnkJLUAAgiuUpcj***WQONNjRPRLmQb9687AMLKH5HBED--CDNEEGSIRFK454444578A8888ENKDNPIFJKQNXccrrJJJqXfajhaXcVaOPGAIAEBXZSanstQEGEEEEGHCHCDaSWPLeb7OXl********u*******tppqn***cjs**Zkfkkjhg**STUWXWSUTTTTTTTPRNWRtUTXqsVMUOZkjLMsuWOLTbUYcajhmhljqjiiihhhcchlgjiTTTTTUVWVTTTUmbfWVYgfhdf*o*********f*bfzuuVWWS*hdfi*RfRH**feVZdbOVfTgfLQSOLXSMMJFIFGHbR***TLl************z***-Yd*XR*ex**K7**************GGIz*********FFFFFFFFnSWFNeP*55334333333353334555445565353I789BCz**t*******jonpm****yswvex******uAHssjzcmck******RebHSGKYMCCCCCBCJJMUggU**MaOqZRdiYWeGYPZLSVYKSQRPQkhRyFGIKDEDDFCD696776766BH99FGFjgqKoRVHPFmNQTURIRYQQQPPQWTTWV5-8DJFF111111*q**Q*lnqqnnoookl-qmmmllnmmmromjjmjjn*****ddXjjfggjijiihhihgg*gcahigjI2y***********23DFBBABCGHJIFHtd*SRRYORGJLHIQJOVIJLJJEQEJQdWihfgj*z*ksnmkX***A88689888LXkjqegffgjpomnKKFEBEFDDDCABA24EMMMEGEF58765767oBOA7669-4795AD6DCC77C677556TciQPasZeW9XJ --11QU7-PG37BMGB6A46BD9C9ECCC4646D987967567777E89ECCKCCCH6598A4232541-5422244-431433221--526642354353168962EBQSDKGUNUB994BJIff7b7v*Y3YIZHCB7T8BdM7H967PA9*APHBjBN*8VEF7cKLhSSKB7995*898ACSDFt5eO5AgPaaG ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-12| PSIPRED cccccccccccEEEEEEEEEEEccEEEEcccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccccccccccHHHHHHcccccccccccccccccHHHHHHHHHHHHccHHHHHccccHHHHHHHHHHHHHHcccHHHHccccHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHHcHHHHHHHccc //