[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88156.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  88/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:174 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  1->24 1e6cA  c.37.1.2 * 5e-05 37.5 %
:RPS:SCOP  3->168 1n25A  c.37.1.20 * 1e-04 8.6 %
:HMM:SCOP  3->157 1lw7A2 c.37.1.1 * 3e-13 26.1 %
:HMM:PFM   3->25 PF03193 * DUF258 0.00051 39.1 23/161  
:BLT:SWISS 3->79 Y395_GRABC 4e-05 35.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88156.1 GT:GENE AAK88156.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2393099..2393623 GB:FROM 2393099 GB:TO 2393623 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88156.1 GB:DB_XREF GI:15157598 LENGTH 174 SQ:AASEQ MNRFFILSGCSGGGKSTLLAELARRGFATVEEPGRRIVIEETRNGGTALPWIDMQAFARRAIAMALEDRRVTPKEGLVFFDRGLIDAASALHHISGDRFVNTLRDTHRYNSLVFLTPPWPEIYQSDDERKHGFDAAVEEYERLVRDYEGLGYDIVVLPKSAVAERADLILTRIG GT:EXON 1|1-174:0| BL:SWS:NREP 1 BL:SWS:REP 3->79|Y395_GRABC|4e-05|35.1|77/324| HM:PFM:NREP 1 HM:PFM:REP 3->25|PF03193|0.00051|39.1|23/161|DUF258| RP:SCP:NREP 2 RP:SCP:REP 1->24|1e6cA|5e-05|37.5|24/170|c.37.1.2| RP:SCP:REP 3->168|1n25A|1e-04|8.6|163/362|c.37.1.20| HM:SCP:REP 3->157|1lw7A2|3e-13|26.1|153/0|c.37.1.1|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 96 OP:NHOMOORG 88 OP:PATTERN -------------------------------------------------------------------- --1--------------------------------------1------------------------1----------------------------------1111----1---------------11-11--1-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1--------------------1---1--1--111--1111--111--11-1-1121-11-----------------1-------------------------------1---------1111111111111--11111111----1-----------------------1----------------------1-------------------1-------------------------------------------------1------------------------1------------------------------------------1-----1-----------------------------------------2222----1-----------------------------1--------------------------111111112122------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 174-175| PSIPRED ccEEEEEEccccccHHHHHHHHHHcccEEEccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHcccHHHHHHHHHHcccccEEEEccccHHHccccccccccHHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHcc //