[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88160.1
DDBJ      :             ABC transporter, nucleotide binding/ATPase protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  907/915 : Eukaryota  194/199 : Viruses  1/175   --->[See Alignment]
c.37.1
:242 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   6->237 1ji0A PDBj 5e-62 58.3 %
:RPS:PDB   5->237 3b5jA PDBj 2e-38 24.8 %
:RPS:SCOP  1->237 1ji0A  c.37.1.12 * 9e-49 54.5 %
:HMM:SCOP  3->243 1g6hA_ c.37.1.12 * 4.6e-60 37.5 %
:RPS:PFM   46->166 PF00005 * ABC_tran 1e-10 37.6 %
:HMM:PFM   46->165 PF00005 * ABC_tran 5.1e-23 33.6 116/118  
:HMM:PFM   28->63 PF03193 * DUF258 1.4e-05 28.6 35/161  
:HMM:PFM   221->237 PF12399 * BCA_ABC_TP_C 4.2e-05 47.1 17/23  
:BLT:SWISS 6->239 BRAG_PSEAE 5e-73 59.2 %
:PROS 139->153|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88160.1 GT:GENE AAK88160.1 GT:PRODUCT ABC transporter, nucleotide binding/ATPase protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2396266..2396994) GB:FROM 2396266 GB:TO 2396994 GB:DIRECTION - GB:PRODUCT ABC transporter, nucleotide binding/ATPase protein GB:PROTEIN_ID AAK88160.1 GB:DB_XREF GI:15157602 LENGTH 242 SQ:AASEQ MSGEPLLKVQGVETYYGNIRALAGVDVEVKKGEIVSLIGANGAGKSTLMMTICGSPQARTGQVIFDGEDITQLPTHLIARKRIAQSPEGRRIFPRMTVLENLQMGANLDNLKYFKEDVEKIFVMFPRLKERQSQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGIFEAIKKLNKEEGLTVFLVEQNAFAALKLSDRAYVMVNGKVTMSGSGRELLADPQVRAAYLEGGRH GT:EXON 1|1-242:0| BL:SWS:NREP 1 BL:SWS:REP 6->239|BRAG_PSEAE|5e-73|59.2|233/233| PROS 139->153|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 6->237|1ji0A|5e-62|58.3|223/231| RP:PDB:NREP 1 RP:PDB:REP 5->237|3b5jA|2e-38|24.8|230/243| RP:PFM:NREP 1 RP:PFM:REP 46->166|PF00005|1e-10|37.6|117/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 46->165|PF00005|5.1e-23|33.6|116/118|ABC_tran| HM:PFM:REP 28->63|PF03193|1.4e-05|28.6|35/161|DUF258| HM:PFM:REP 221->237|PF12399|4.2e-05|47.1|17/23|BCA_ABC_TP_C| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 1->237|1ji0A|9e-49|54.5|235/240|c.37.1.12| HM:SCP:REP 3->243|1g6hA_|4.6e-60|37.5|240/254|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 48027 OP:NHOMOORG 1170 OP:PATTERN UUIBPKIJXWWUVRdMmGQSOQQZuLQgjRdVHBEDECJIJFDVZNXjMQ*zf9QdQWWQTKHDY27A NYmK*XTZjjmRUNXSTQP-PgCCZ*QQQQQPsnlpp***W*Z*s*mflgYS*yzQNdDFvv*b*p****hWTSSrXXVOsZoCAB7CQPOF8KEJI--EGSLNJfNYLP6788887AA98888IVRJTWQJQUaVmww**MLM*ZsmtugglagUVHFKGLFmhbj***WJSDKGHKSIJEHnaaWTphAUg*************************dp***frwwvstt**ahhjjjhfiihhhihaZUWa*caYz*aOaXgwvOO**eWPajlehimmqurowuuupuqsnnrworrdddcbdddgedccyppedfrpsop*x*********k*mw***almi*qhsr*csRJ**qocbioSbjaqoOYdVMeUTTLJNMJMcV***WSq****************-mn*gc*m***UA**************KLK**********POPPPPPPwUYDPha*77667555565788CD68AA9988A8694NDDDCD***************y********n********BO**y*ktmo******bpiLZMTjVIIHGJGHQRMYngb**QgXwfUjuZXlIfacTVWgSWZaVaswa*JKKSEKJKLIDA9BCCBDBBEREGKKJmjtRsTYKTOwSQSTRNSbTQRQWTZYTXW5-EIQKM33-333*z**V*yy***z***yx-*yx**z**z****uwxwvv*****kienmjkmonnnmjlolki*rnmwwuwT4************44KIDGDDDNOOONJ*k*VWVWUWGNPMLUOTcNPSPPIVGNRpavvttx***n***zj***GFEDDGFDFJblixkjmljx*svsNNNKILLGHGA99965OVSRKLLN89888889*BcCB98B-AD79CD8LKIB7HABA667botVZl*mpiFaQ -1--YWI-UG78NXOHDIEBJIFMDLIFE8C9BKHJAEBCBEDBCBEAHLJJXJEHH9BEBDC7666627B6B978C25977457756-FG6DA8AA78CA8BHIA4HVg*SbWmdeMHFBKWKwrByE**r4sTuJNHEhDImbCMIDEgDB*HaVSvKm*MnQb9*Yg*ggZPGHE9*798DHqWY*C*eHI*kwqL ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 240-242| PSIPRED cccccEEEEEcEEEEEccEEEEEcccEEEcccEEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHcccccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHcHHHHHHcccccccHHHHHHHHHHHHHHccccEEEEcccHHcccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHccHHHHHHHcccccc //