[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88165.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  47/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
b.22.1
:345 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   45->102 3dkqC PDBj 2e-04 12.1 %
:RPS:SCOP  235->324 1u5xA  b.22.1.1 * 6e-05 13.3 %
:RPS:PFM   23->107 PF10983 * DUF2793 4e-20 50.6 %
:HMM:PFM   23->108 PF10983 * DUF2793 1.2e-30 41.9 86/87  
:HMM:PFM   261->327 PF00386 * C1q 1.8e-05 25.8 66/127  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88165.2 GT:GENE AAK88165.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2401667..2402704 GB:FROM 2401667 GB:TO 2402704 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88165.2 GB:DB_XREF GI:159140691 LENGTH 345 SQ:AASEQ MEQTARLRLPYILPSQAQKHVTHNEALQRLDAIVQLVIRATVTAPPENAAEGDCFLLSADATGDWAGKGGRLAFRQDGAWLSITPQSGWTAWFVTDARYRVLQDGNWRDLPLPATGRLERLGIGTDADANNRMALASPASLFTHTQEDGSHRLTVNKAGKADTASLLFQSGWSGRAEMGLAGSDGFSIKTSRDGTSWHTALLCSGEGRVSIPNRPLAVAGQPAGTTKPANGSAAGFSVLVIAEGGFALGDAVSGGGRDLVIPAKGIYLVMLSLAVVASSGHRVTLTVNGAAANFSVAGNASIAGTTQSATALLSLDAGDRLRLQHEGMVELTQGSGKTCLSLAAL GT:EXON 1|1-345:0| TM:NTM 2 TM:REGION 259->281| TM:REGION 288->310| RP:PDB:NREP 1 RP:PDB:REP 45->102|3dkqC|2e-04|12.1|58/216| RP:PFM:NREP 1 RP:PFM:REP 23->107|PF10983|4e-20|50.6|85/87|DUF2793| HM:PFM:NREP 2 HM:PFM:REP 23->108|PF10983|1.2e-30|41.9|86/87|DUF2793| HM:PFM:REP 261->327|PF00386|1.8e-05|25.8|66/127|C1q| RP:SCP:NREP 1 RP:SCP:REP 235->324|1u5xA|6e-05|13.3|90/130|b.22.1.1| OP:NHOMO 56 OP:NHOMOORG 48 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-------1---122111111111111111--11-115111-1--1-1----------1-111311111-1----------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------- STR:NPRED 58 STR:RPRED 16.8 SQ:SECSTR ############################################EEETTEEEccEEEEEEcccGGGEEEccEEEEccccEEEEcccTTcEEEEETTcEEEEc################################################################################################################################################################################################################################################### DISOP:02AL 1-2| PSIPRED ccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccEEEEcccccHHHccccccEEEEEccEEEEEccccccEEEEEcccEEEEEEccccccccccccccccEEEEEcccccccEEEEEcccEEEEccccccEEEEEEEcccccccEEEEEEccccEEEEEEccccccEEEEEccccccccEEEEEEccccccccccEEEEccccccccccccccccccEEEEEEcccccccccccccccEEEEEcccHHHHHHHHHHHHccccEEEEEEcccccEEEEEccccEEccccccEEEEEEccccEEEEEccccEEEEcccccEEEEEEcc //