[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88169.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:198 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88169.1 GT:GENE AAK88169.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2404215..2404811 GB:FROM 2404215 GB:TO 2404811 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK88169.1 GB:DB_XREF GI:15157613 LENGTH 198 SQ:AASEQ MHGRPVIESRLLIHRQPSMTTIVHLVSRQSSGAGADRSVAVFQRRGLFIFGLHFFQRSFRRFLLGLQFPDRDLKIIRPLARGLGEGRIGEMRRIGNARLAFLQRDLMHQFLCHPLEFGHHLLQLVKLPAFFVDLKFLQANQAVTRLHTQYSMDSETRIKKALCPLIGPFNPPVQPAGLTRCAGMIPKSYPTLIKNRRR GT:EXON 1|1-198:0| SEG 81->95|rglgegrigemrrig| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 30-34, 196-198| PSIPRED ccccccHHHHHHHcccccHHHHHHHHHHccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccccHHHHHHHccccccHHHHHcccc //