[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88174.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  53/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:175 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   94->171 3juwA PDBj 4e-06 33.8 %
:RPS:PDB   8->173 2bueA PDBj 2e-09 11.1 %
:RPS:SCOP  3->163 2fckA1  d.108.1.1 * 3e-14 22.7 %
:HMM:SCOP  1->155 2fckA1 d.108.1.1 * 1.4e-25 25.5 %
:HMM:PFM   108->154 PF00583 * Acetyltransf_1 5.3e-06 19.6 46/83  
:BLT:SWISS 55->150 GUAA_HELHP 4e-06 22.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88174.2 GT:GENE AAK88174.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2407696..2408223) GB:FROM 2407696 GB:TO 2408223 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88174.2 GB:DB_XREF GI:159140478 LENGTH 175 SQ:AASEQ MTRLATARLVLRPHAISDEALYCAFWAAAVRPIEGVTSIAPLDPELAFARLLRFIGHWSVFGFGPFVVEELATGRIVGEVGFAHMRRGNGADFDGVPEAMWKIDGQLTGRGVATEAVEAATRWFDESGTSQRTVCMIDALNTPSLAIATRFGFHPFREMMFRNNPVRLFERVRGK GT:EXON 1|1-175:0| BL:SWS:NREP 1 BL:SWS:REP 55->150|GUAA_HELHP|4e-06|22.9|96/1375| BL:PDB:NREP 1 BL:PDB:REP 94->171|3juwA|4e-06|33.8|77/162| RP:PDB:NREP 1 RP:PDB:REP 8->173|2bueA|2e-09|11.1|162/179| HM:PFM:NREP 1 HM:PFM:REP 108->154|PF00583|5.3e-06|19.6|46/83|Acetyltransf_1| RP:SCP:NREP 1 RP:SCP:REP 3->163|2fckA1|3e-14|22.7|150/174|d.108.1.1| HM:SCP:REP 1->155|2fckA1|1.4e-25|25.5|149/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 57 OP:NHOMOORG 54 OP:PATTERN -------------------------------------------------------------------- -11-1------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------1--111111111111---2-11-----111-----------------------------------------------111--1-1-111111-111---111111--111----------------------------------------------------------------------2--------------------------------------------------------------------------------------------------------------------------------------1------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------2---------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 173 STR:RPRED 98.9 SQ:SECSTR EEEEccTcEEEEEccGGGHHHHHHHHTcHHHHTTccGGGccccHHHHHHHHcHHHHHTTEEEETEEEEEEEETTEEEEEEEEEEGGGccTTccTTcccTTEEccGGGTTccHHHHHHHHHHHHHHTcTTccEEEEcccTTcHHHHHHHHHTTcEEEEEEEETTEEEEEEEEEH## DISOP:02AL 174-176| PSIPRED ccEEEcccEEEEcccHHHHHHHHHHHccHHHEEEcccccccccHHHHHHHHHHHHHHHHHcccEEEEEEEccccEEEEEEEEEEcccccccccccccEEEEEEcHHHccccHHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHcccEEEEEEEEcccEEEEEEEcccc //