[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88187.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:107 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88187.2 GT:GENE AAK88187.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2421984..2422307) GB:FROM 2421984 GB:TO 2422307 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK88187.2 GB:DB_XREF GI:159140482 LENGTH 107 SQ:AASEQ MGVSQAKMSEPGPHRLQNPAIPSDTPQRCGPSSFPTLPGIRGDGARAYSKKSIRCPKMKTDKIVAIGLKRLKTVVCHCGITDREWPLKRRSGNEIETGTSRRIANGV GT:EXON 1|1-107:0| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-19,94-94,96-96,107-108| PSIPRED ccccHHHccccccHHccccccccccccccccccccccccccccccHHHccccccccccccccEEEEEHHHHHHHHHHcccccccccccccccccccccccHHHcccc //