[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88191.1
DDBJ      :             iron-chelator utilization protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  193/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
b.43.4
:358 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   179->353 2gpjA PDBj 5e-13 32.3 %
:RPS:PDB   112->341 1cnfA PDBj 3e-07 13.1 %
:RPS:SCOP  109->225 2piaA1  b.43.4.2 * 3e-07 18.5 %
:HMM:SCOP  96->234 1i7pA1 b.43.4.2 * 3.8e-06 23.5 %
:RPS:PFM   27->95 PF09981 * DUF2218 2e-04 29.0 %
:RPS:PFM   112->227 PF08021 * FAD_binding_9 6e-13 37.7 %
:RPS:PFM   232->353 PF04954 * SIP 7e-10 33.9 %
:HMM:PFM   113->227 PF08021 * FAD_binding_9 1.9e-31 37.2 113/117  
:HMM:PFM   232->353 PF04954 * SIP 3.5e-30 37.8 119/119  
:HMM:PFM   12->96 PF09981 * DUF2218 3.9e-09 22.4 85/89  
:BLT:SWISS 141->357 VIUB_VIBVU 6e-20 27.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88191.1 GT:GENE AAK88191.1 GT:PRODUCT iron-chelator utilization protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2425266..2426342) GB:FROM 2425266 GB:TO 2426342 GB:DIRECTION - GB:PRODUCT iron-chelator utilization protein GB:PROTEIN_ID AAK88191.1 GB:DB_XREF GI:15157639 LENGTH 358 SQ:AASEQ MPVSLLSAETSVSLPDPLSIVKAFEDHFSEHMEMERDGSTVRFKTEYGHGSFSAEGGRFAARVNCVSEHILMSVKAMVAEHIAEFSGEAGLDFRWSGHGAEQRELPNLFRGKVARAYNLTPHMRRLVVSVESGIDRLLTGGMHVRLLLVPDQARAPVWPHLAPTGAIIWPEGDDLLTRRVYTIRSGDVGRGEVDIDFVMHEGDHMPGATFGATAKPGDVVGIVGPSGVCPEADRYVFAGDETALPVMLRMAAEMPAGKKLSVYAEIDDEAERQEVVCAADVEWTWLYRRGKPAGTSGLIEKALREHAWSAEHDGLHVFAACEKSEARAVKSFLTDEIGFPKASLRAVGYWTMGAADDH GT:EXON 1|1-358:0| BL:SWS:NREP 1 BL:SWS:REP 141->357|VIUB_VIBVU|6e-20|27.5|211/271| BL:PDB:NREP 1 BL:PDB:REP 179->353|2gpjA|5e-13|32.3|167/240| RP:PDB:NREP 1 RP:PDB:REP 112->341|1cnfA|3e-07|13.1|206/260| RP:PFM:NREP 3 RP:PFM:REP 27->95|PF09981|2e-04|29.0|69/89|DUF2218| RP:PFM:REP 112->227|PF08021|6e-13|37.7|114/117|FAD_binding_9| RP:PFM:REP 232->353|PF04954|7e-10|33.9|118/118|SIP| HM:PFM:NREP 3 HM:PFM:REP 113->227|PF08021|1.9e-31|37.2|113/117|FAD_binding_9| HM:PFM:REP 232->353|PF04954|3.5e-30|37.8|119/119|SIP| HM:PFM:REP 12->96|PF09981|3.9e-09|22.4|85/89|DUF2218| RP:SCP:NREP 1 RP:SCP:REP 109->225|2piaA1|3e-07|18.5|92/103|b.43.4.2| HM:SCP:REP 96->234|1i7pA1|3.8e-06|23.5|115/125|b.43.4.2|1/1|Riboflavin synthase domain-like| OP:NHOMO 271 OP:NHOMOORG 195 OP:PATTERN -------------------------------------------------------------------- ----12-133111-32211-11--23111112122217431112232122213221-1--32--5342281-----------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-----------------1--1-----------1---------1---322----121112-----141-11---11111111-11-----------------------------------------11-11111111111111111111-11111111--11------2-1-1--1----11--------------1---------------------------11-----------------------------11-1-1--2---1111-1-1111----1-----------------1---1---------------------------------11111--------------------------1--------------------------1-2---------------11111----1-----11111-1111-111-----------11111111112112211111------------------------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 242 STR:RPRED 67.6 SQ:SECSTR #########################################################################################################cccEccEEEEEEEEETTEEEEEEEcccTTcccccTTccccccc######TccccccTTcEEEEEcEETTEEccEEEcccccTTcccEEEEEEEccccccccccTccTTccTTcEEEEccccEETTEEcccEEEEETTTTHHHHHHHHHHHTTTTccccHHHHHHHHHcEccEEEcccccTTccccccTcEEccccHHHHHTTcccccTTEEEEEEccHHHHHHHTTTTTTTTTccTTGETccccEEET##### DISOP:02AL 1-3, 354-358| PSIPRED ccccEEEcccEEccccHHHHHHHHHHHHHHccEEEccccEEEEEEEccEEEEEEEccEEEEEEEcccHHHHHHHHHHHHHHHHHHccccccccEEcccccccccccccEEEEEEEEEEEcccEEEEEEEcccccccccccccEEEEEEcccccccccccEEcccccEEcccccccccccccEEEEEcccccEEEEEEEEEcccccHHHHHHHHcccccEEEEEccccccccccEEEEEEcHHHHHHHHHHHHHcccccEEEEEEEEccHHHHHccccccccEEEEEEccccccccHHHHHHHHHHHHcccccccEEEEEEccHHHHHHHHHHHHHHHcccHHHEEEEEEccccccccc //