[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88199.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  82/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
e.62.1
:174 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   45->173 2hqvA PDBj 2e-68 100.0 %
:RPS:SCOP  2->173 2hqvA1  e.62.1.2 * 4e-35 80.4 %
:HMM:SCOP  1->173 2hqvA1 e.62.1.2 * 2.3e-44 32.9 %
:RPS:PFM   46->169 PF06228 * DUF1008 2e-28 44.4 %
:HMM:PFM   31->168 PF06228 * DUF1008 8.1e-49 40.9 137/141  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88199.2 GT:GENE AAK88199.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2431522..2432046 GB:FROM 2431522 GB:TO 2432046 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88199.2 GB:DB_XREF GI:159140489 LENGTH 174 SQ:AASEQ MSIAAQKNDDDRQARALAALAEKPDGIVEAIAAKAEVAPAEILAILPQGAAVSAPADRFDAIWNEMRGWGEILMIVQTGDIVLEVPGHLPEGTESHGWFNIHGDSPIGGHIKKDNCAAITFVDRGFHGRRSCSVWFMNAAGGAMFKIFVRRDENKELLAGQLAKFEELRDGFRG GT:EXON 1|1-174:0| SEG 9->21|dddrqaralaala| SEG 27->44|iveaiaakaevapaeila| BL:PDB:NREP 1 BL:PDB:REP 45->173|2hqvA|2e-68|100.0|125/167| RP:PFM:NREP 1 RP:PFM:REP 46->169|PF06228|2e-28|44.4|124/140|DUF1008| HM:PFM:NREP 1 HM:PFM:REP 31->168|PF06228|8.1e-49|40.9|137/141|DUF1008| RP:SCP:NREP 1 RP:SCP:REP 2->173|2hqvA1|4e-35|80.4|168/172|e.62.1.2| HM:SCP:REP 1->173|2hqvA1|2.3e-44|32.9|173/0|e.62.1.2|1/1|Heme iron utilization protein-like| OP:NHOMO 83 OP:NHOMOORG 83 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1111111-------------------------111-------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------1------------------------11----------11111-11--1-1111-1-----1-------1---1---111-111---1---111-1-111---------11----------------------1------111111111111------------------111---1----1111---------------------------------------11111111111111------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 74.1 SQ:SECSTR ############################################TccTTcEEEEEGGGHHHHHHHHTTcccEEEEEEccccEEEEEEccccEEEETTEEEEcccccccEEEcGGGEEEEEEEEEEETTEEEEEEEEEETTccEEEEEEccccTTccccHHHHHHHHHHHHHHc# DISOP:02AL 1-11,173-175| PSIPRED ccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHccEEEccHHHHHHHHHHHHccccEEEEEEcccEEEEEEccccccccccEEEEEccccccccEEEEEEEEEEEEEEccccccccEEEEEEEccccEEEEEEEccccHHHccHHHHHHHHHHHHHHcc //