[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88205.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  226/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:314 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->312 2qpqA PDBj 6e-21 28.2 %
:RPS:PDB   24->312 2dvzA PDBj 2e-31 23.4 %
:RPS:SCOP  20->269 1us4A  c.94.1.1 * 1e-14 16.0 %
:HMM:SCOP  19->314 1us5A_ c.94.1.1 * 5.3e-09 21.2 %
:RPS:PFM   39->309 PF03401 * Bug 3e-30 36.7 %
:HMM:PFM   39->311 PF03401 * Bug 8.8e-36 29.4 269/274  
:BLT:SWISS 25->300 YFLP_BACSU 1e-26 24.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88205.1 GT:GENE AAK88205.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2437809..2438753 GB:FROM 2437809 GB:TO 2438753 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88205.1 GB:DB_XREF GI:15157655 LENGTH 314 SQ:AASEQ MKHFLIGTFLAGVIALPAVAADYTIIAPANPGGGWDQTARSLQTVLQEEGISKSVQVQNVPGAGGTIGLAQFASQQKGNPNALIVGGYVMVGAILTNNAPVTLKEVTPIARLTGEYEAIVVPASSPLKTIGDLVDQLKKDPGSVSWGGGSAGGTDHIAVGLIAKAAGVDPTKINYIAYSGGGEALASILGSQVTAGISSYGEFESQVKAGTLRLLAVSSEEKLDGVDAPTLKESGLDVVVQNWRMVAAPPGLTPEQEKAVNADIEKLVKSAKWQETLKTKSWMDTYLAGDEFKAQLAKDTDATAAILKDIGLVK GT:EXON 1|1-314:0| BL:SWS:NREP 1 BL:SWS:REP 25->300|YFLP_BACSU|1e-26|24.5|273/319| TM:NTM 1 TM:REGION 3->25| SEG 142->153|gsvswgggsagg| BL:PDB:NREP 1 BL:PDB:REP 25->312|2qpqA|6e-21|28.2|284/296| RP:PDB:NREP 1 RP:PDB:REP 24->312|2dvzA|2e-31|23.4|278/292| RP:PFM:NREP 1 RP:PFM:REP 39->309|PF03401|3e-30|36.7|267/274|Bug| HM:PFM:NREP 1 HM:PFM:REP 39->311|PF03401|8.8e-36|29.4|269/274|Bug| GO:PFM:NREP 1 GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF03401|IPR005064| RP:SCP:NREP 1 RP:SCP:REP 20->269|1us4A|1e-14|16.0|237/298|c.94.1.1| HM:SCP:REP 19->314|1us5A_|5.3e-09|21.2|278/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 1823 OP:NHOMOORG 229 OP:PATTERN -------------------------------------------------------------------- --------111----------2---2------1222-112----1-------132-1-------212-111-----------2-----------------------------------------------------111--------------------------------------------41---11---11111111--1111113-2211111--114--------2--------------------------------------------------------------------------------------------4---------------------1----1----44-----1-------1---------------S55--753554----------3-1-1-----G---13322265225321---5533-35412--------------1------------------------------1-----K**z*-------------1---------8****3D111G6eXX*V*2**5A------------------------2---1---------------1111----1--1-----1-----------------11--1-----1-1111----11---------------------1111------1-111-------111-1--1-11-113-----11111111111111111111------------------------------------386-----1-----------------1-4-22221111211111111----------1-111111111111-----------------1------------------------------------------------3------ -------------1------------------------------------------------------------------------------------------------------------------------------------------------D-----------------------------L---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 302 STR:RPRED 96.2 SQ:SECSTR ############cETTTccHHHHEEEEcccTTcHHHHHHHHHHHHHHHHTTTTccEEEEcccGGGHHHHHHHHHHccTTccEEEEEcHHHHHHcTTTccccTTTcEEEEEEEEEEcEEEEEcTTcccccHHHHHHHHHTcTTTcEEEEccTTcHHHHHHHHccHHHTccTcEcEEEEcccHHHHHHHHHHTcccEEEEEHHHHHHHHHTTccEEEEEcccccGGGTTcccTTTTTcGGcccEEEEEEEETTcccHHHHHHHHHHHHHHTcHHHHHHHHHHTEEEccccHHHHHHHHHHHHHHHHHHHHcTTccc DISOP:02AL 314-315| PSIPRED cHHHHHHHHHHHHHccHHHcccEEEEEEcccccHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHcccccccEEEEEccHHHHHHHHcccccccHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHcccccEEEEcHHHHHHHHHcccEEEEEEEccccccccccccHHHHcccEEEEEEEEEEEcccccHHHHHHHHHHHHHHHccHHHHHHHHHcccEEccccHHHHHHHHHHHHHHHHHHHHHccccc //