[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88206.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:164 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   49->157 PF07331 * DUF1468 2e-06 35.8 %
:HMM:PFM   19->155 PF07331 * DUF1468 3e-05 19.9 136/144  
:BLT:SWISS 37->133 YHAP_BACSU 6e-04 36.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88206.1 GT:GENE AAK88206.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2438750..2439244 GB:FROM 2438750 GB:TO 2439244 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK88206.1 GB:DB_XREF GI:15157656 LENGTH 164 SQ:AASEQ MSQGSNPLEHQKRRPDWAALAIAVFLVIIACVIFWDSARLASVTGYSPVGPATVPYAIGFCLVGLALWTAVEAWRGDFPERDKQEIAPVIWVVAGLAAQMLLLNVAGFSIATGLLFAFTARAFGKRKLWFSIPVGIVLSFAIWVVFAQLLQLSLPAGPLERLFF GT:EXON 1|1-164:0| BL:SWS:NREP 1 BL:SWS:REP 37->133|YHAP_BACSU|6e-04|36.1|97/419| TM:NTM 4 TM:REGION 19->41| TM:REGION 53->74| TM:REGION 93->115| TM:REGION 131->153| SEG 18->34|aalaiavflviiacvif| RP:PFM:NREP 1 RP:PFM:REP 49->157|PF07331|2e-06|35.8|109/142|DUF1468| HM:PFM:NREP 1 HM:PFM:REP 19->155|PF07331|3e-05|19.9|136/144|DUF1468| OP:NHOMO 24 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1---------------1---------1---111111111111-------11-11-----------------------------------------------------------------------------------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-15| PSIPRED ccccccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHcccEEEEHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHcc //