[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88214.1
DDBJ      :             transcriptional regulator, LysR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  414/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.94.1
:299 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->293 3hhgG PDBj 8e-34 32.5 %
:RPS:PDB   1->96 3broC PDBj 6e-13 9.4 %
:RPS:PDB   89->295 1al3A PDBj 1e-24 16.3 %
:RPS:SCOP  4->103 1b9mA1  a.4.5.8 * 1e-13 7.0 %
:RPS:SCOP  92->292 1ixcA2  c.94.1.1 * 8e-23 13.3 %
:HMM:SCOP  1->113 1b9mA1 a.4.5.8 * 1.2e-21 36.8 %
:HMM:SCOP  87->296 1uthA_ c.94.1.1 * 1.1e-42 32.7 %
:RPS:PFM   4->44 PF00126 * HTH_1 5e-04 36.6 %
:RPS:PFM   90->291 PF03466 * LysR_substrate 6e-22 34.8 %
:HMM:PFM   89->293 PF03466 * LysR_substrate 3.7e-41 31.7 199/209  
:HMM:PFM   5->62 PF00126 * HTH_1 4.1e-20 34.5 58/60  
:BLT:SWISS 1->292 YHJC_ECOLI 2e-50 38.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88214.1 GT:GENE AAK88214.1 GT:PRODUCT transcriptional regulator, LysR family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2446709..2447608) GB:FROM 2446709 GB:TO 2447608 GB:DIRECTION - GB:PRODUCT transcriptional regulator, LysR family GB:PROTEIN_ID AAK88214.1 GB:DB_XREF GI:15157664 LENGTH 299 SQ:AASEQ MDQLSAMRVFTRVVETGNFSRAATALNMPKTTVTNMVQALEAHLQTTLLNRTTRRVMLTTDGALYYERASQILSEIEELDGSMSSAQVQPSGRLRVEMAGVFADLVVIPHLCEFYQRYPQIRLDLGVGDRLVDYIAENVDCALRVGVLRDQSLIARKVGELRFETFASPSYIENFGMPREPEDLEKEHYSVGYLNATTGQIMPASFDNGVRSVELTPNYVVSVNDSRTYLNAALAGMGIVQLPVFMVRDALSRGELVPVLSEWRREAMPIYVVYPQTRHVTNKVRVFVDWLAKLVHGLV GT:EXON 1|1-299:0| BL:SWS:NREP 1 BL:SWS:REP 1->292|YHJC_ECOLI|2e-50|38.0|287/299| SEG 46->60|ttllnrttrrvmltt| BL:PDB:NREP 1 BL:PDB:REP 7->293|3hhgG|8e-34|32.5|283/294| RP:PDB:NREP 2 RP:PDB:REP 1->96|3broC|6e-13|9.4|96/129| RP:PDB:REP 89->295|1al3A|1e-24|16.3|202/237| RP:PFM:NREP 2 RP:PFM:REP 4->44|PF00126|5e-04|36.6|41/60|HTH_1| RP:PFM:REP 90->291|PF03466|6e-22|34.8|198/207|LysR_substrate| HM:PFM:NREP 2 HM:PFM:REP 89->293|PF03466|3.7e-41|31.7|199/209|LysR_substrate| HM:PFM:REP 5->62|PF00126|4.1e-20|34.5|58/60|HTH_1| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 2 RP:SCP:REP 4->103|1b9mA1|1e-13|7.0|100/122|a.4.5.8| RP:SCP:REP 92->292|1ixcA2|8e-23|13.3|196/205|c.94.1.1| HM:SCP:REP 1->113|1b9mA1|1.2e-21|36.8|106/0|a.4.5.8|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 87->296|1uthA_|1.1e-42|32.7|205/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 5309 OP:NHOMOORG 423 OP:PATTERN -------------------------------------------------------------------- -------------------------2-----------1----------------1----------------------------------------------------------------------------------11-------511111-----------12-3--------------------------1------------------------11-11--------1---------------------------------------------------------------------------------------------1-1------------------1----2-------1-------------2--E33211111L6OJH446492945565456566F-BGDA8G9GAa31fTTCXYMqgcXWJE5654BD53665B6555555559ED69549-----------------------------1-5C54BPLET******TLOPLiiyqUUVVJa*jqNbeQ-1NLRA8F88hBOBj37M51669S622222221213F651-1--121-111---------1-693A6H-1-------------------------11JDI766X3DC58GJIGAHFGCCBFFHKDRK---11-2------CF8M1HC8AA9889887-A888A86898A8C888884VgUJF474A6A8A9A99B999988b75655653-F99AAAA88AAA---2-2--2223312OBJ777C2H122314---JKJKK79455T4acVaSbdQNMOPU9JJL4633366461DIHTCCCCCGKMEDVV9DEDB1124111--1-------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------1--------------2----3------F--5----------11--8-----7---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 295 STR:RPRED 98.7 SQ:SECSTR HHHHHHHHHHHHHHHHccHHHHHHHHTccHHHHHHHHHHHHHHHTcccccccccHHEEcHHHHHHHHHHHHHHHHHHHHHHHHHcTTcccEEEEEEEEcHHHHHHTcHHHHHHHHHHcTEEEEEEEEccHHHHHHTTcccEEEEccccTTccEEEEEEEEEcEEEEEcTTcTTTTTccccHHHHHTcEEEEEEEEEcTTcTTHHHHHHHHHHHTcccEEEEEEccHHHHHHHHHHTccEEEEEGGGccTHTTcTTcEEEEccTTcccEEEEEEEETTccccHHHHHHHHHHcTTc#### DISOP:02AL 85-87| PSIPRED cccHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHcccEEEEcccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHHHHHccccEEEEEEccccccHHHccEEEEEEcccccccccEEEEEccccEEEEEcHHHHHcccccccHHHHHcccEEEEEccccccccEEEEEccccEEEEEEccccEEEccHHHHHHHHHHcccEEEHHHHHHHHHHHccccEEEccccccccccEEEEEcccccccHHHHHHHHHHHHHHHccc //