[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88236.1
DDBJ      :             ABC transporter, substrate binding protein (sugar)
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  188/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:443 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   62->372 1eu8A PDBj 2e-13 30.1 %
:RPS:PDB   39->385 3ehtA PDBj 2e-30 16.8 %
:RPS:SCOP  42->440 1eu8A  c.94.1.1 * 4e-30 19.1 %
:HMM:SCOP  41->438 1eljA_ c.94.1.1 * 9.6e-62 31.3 %
:RPS:PFM   65->351 PF01547 * SBP_bac_1 1e-13 34.1 %
:HMM:PFM   56->348 PF01547 * SBP_bac_1 6.1e-40 23.3 283/314  
:HMM:PFM   8->27 PF10518 * TAT_signal 0.00019 50.0 20/26  
:BLT:SWISS 10->380 Y4OP_RHISN 3e-30 29.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88236.1 GT:GENE AAK88236.1 GT:PRODUCT ABC transporter, substrate binding protein (sugar) GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2473048..2474379 GB:FROM 2473048 GB:TO 2474379 GB:DIRECTION + GB:PRODUCT ABC transporter, substrate binding protein (sugar) GB:PROTEIN_ID AAK88236.1 GB:DB_XREF GI:15157692 LENGTH 443 SQ:AASEQ MTHSLLNPTRRAFLAGTAAIGGSAMLGIRPASAAVNWKKHAGTTLEVNLVKSPRSETLIKYLGEFEELTGIKVNAEATPEQQQRQKVVIELSSGKPSFDVVHLSYHVQKRQFEKGKWLADISGFLKDPSLTDPSLVEKDFAEAGMLFAKDSDGVLRSLPFSVDYWIVYWNKELFEAKGLKYPETFEELVTAAEKITDPATNTYGFVARGLKNANTPVWTSLMLGYGAKPISADGKIDTESKEAVEAAKLYQRLMTKAAPPGVSGFNWAEAQSAFLQGKIGMWFDGVGFAPPIENPEKSRVVGKVGYGVMPKGPAVQAAGTFGDGLGVVEASSKKEAAYLFCQWAISHDMGARLLQAGAGVPFRQSILEDQKVREGVKMPAAWLDAVVGSGKVSQLALPVIIPVTEFRDIYGVGLTNMIGGADPAAELKKATEQFAPVLARSEG GT:EXON 1|1-443:0| BL:SWS:NREP 1 BL:SWS:REP 10->380|Y4OP_RHISN|3e-30|29.2|359/431| BL:PDB:NREP 1 BL:PDB:REP 62->372|1eu8A|2e-13|30.1|302/407| RP:PDB:NREP 1 RP:PDB:REP 39->385|3ehtA|2e-30|16.8|322/452| RP:PFM:NREP 1 RP:PFM:REP 65->351|PF01547|1e-13|34.1|261/282|SBP_bac_1| HM:PFM:NREP 2 HM:PFM:REP 56->348|PF01547|6.1e-40|23.3|283/314|SBP_bac_1| HM:PFM:REP 8->27|PF10518|0.00019|50.0|20/26|TAT_signal| GO:PFM:NREP 2 GO:PFM GO:0005215|"GO:transporter activity"|PF01547|IPR006059| GO:PFM GO:0006810|"GO:transport"|PF01547|IPR006059| RP:SCP:NREP 1 RP:SCP:REP 42->440|1eu8A|4e-30|19.1|388/407|c.94.1.1| HM:SCP:REP 41->438|1eljA_|9.6e-62|31.3|364/380|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 418 OP:NHOMOORG 191 OP:PATTERN ------------------------2------------------------------1------------ ----2----------------1---3------1333-112--12421-----123--2----1-2-2243------------2------------------1-------1--------------------------11111----112-------11----11--------------------52-11-1-11-----------------1-------1------1--1--48------------------------------------------------------------------------------------------1--------------11----------11----------3---1--11--------------2-534--------33322232334---------18--9661679BB997-----344211242---------3112--11------------------------------------111-222222122221113222212311--------12----1--135----1----------------------------------------------2--------------------------------1----1-----------------------------------121---------------------------------121--------------------------------11111111111---------------332-------------------------1-111111121---11222---------------------------------------------------------1--------------------------1541113-21--- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 439 STR:RPRED 99.1 SQ:SECSTR ###ccTTcEEEEccccccccccccEEEEEccTTccEc#cccccEEEEEEcccccHHHHHHHHHHHHHHHccEEEEEccTTHHHHHHHHGHHHGGTccccEEEEETHHHHHHHHHHTccccccccTTTTTTccTTHHHHTEEcHHHHHHHEETTEEcEEEEEEEccEEEEETTTccHHTcccccccTHHHHTTHHHHHTTcEEEccccccHHHHHHHHHHHTcEEEEEccccEEEEEEcccHHHHHHHHHHHHHHTTTccccGGcccHHHHHHHHHHTcEEEEEEcGGGHHHHHHTTccccEccEEEEcccEETTEcccEEEEEEEEEcTTcccHHHHHHHHHHTTccHHHHHHHHHHccccEEccHHHHHHHTTcHHHHHHHHHHEEcHHcEEEEcTTTTcccHHHHHHHHHHHHHHHHHccHHHHHHHHHccHHHHcccEcc DISOP:02AL 1-7, 442-443| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEccccHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHcccccccHHHHcccccccHHHHHHHHHHHHHHHccccccEEEEEEEEEccEEEEEEHHHHHHccccccccHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHcccEEEEEccHHHHHHHHHHccccccccEEEEEccccccccccEEEEEEEEEEcccccHHHHHHHHHHHHcHHHHHHHHHHcccccccHHHHccHHHHHHHcccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcc //