[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88237.1
DDBJ      :             ABC transporter, membrane spanning protein (sugar)
Swiss-Prot:             

Homologs  Archaea  38/68 : Bacteria  566/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:312 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->261 3fh6F PDBj 7e-16 25.7 %
:RPS:PDB   22->183 3b8eA PDBj 1e-04 11.9 %
:RPS:PDB   198->235 3dhwA PDBj 5e-05 28.9 %
:RPS:SCOP  69->275 2r6gF2  f.58.1.1 * 3e-30 23.7 %
:RPS:PFM   102->259 PF00528 * BPD_transp_1 2e-11 34.5 %
:HMM:PFM   100->299 PF00528 * BPD_transp_1 5.5e-23 19.4 175/185  
:BLT:SWISS 31->277 Y4OQ_RHISN 1e-52 38.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88237.1 GT:GENE AAK88237.1 GT:PRODUCT ABC transporter, membrane spanning protein (sugar) GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2474379..2475317 GB:FROM 2474379 GB:TO 2475317 GB:DIRECTION + GB:PRODUCT ABC transporter, membrane spanning protein (sugar) GB:PROTEIN_ID AAK88237.1 GB:DB_XREF GI:15157693 LENGTH 312 SQ:AASEQ MASVSIENTKTGVSRAEGSRPPRLAPNYWPFVIPALVVISAVIVFPWVFTLWMSVHRWTLGQEQSFIGFDNYIRLASDLRFWESLWHTLIYTVLSVVAPLFLGTLAALVFDAQFPLRGFLRGVFVMPMMATPVAIALVWTMMFHPQLGVLNYLLSLIGIGPLEWIYNQSTVIPSLVLVETWQWTPLVMLIVLGGLAAVPREPYESAEIDGANAWQKFRYLTMPMIAPFLMIAVIIRSIDAVKSFDIIYAMTQGGPGTASETINIYLYNTAFSYYDIGYGSAMAVVFFVIIVALSFVLLMVRQRSQWNEMEEH GT:EXON 1|1-312:0| BL:SWS:NREP 1 BL:SWS:REP 31->277|Y4OQ_RHISN|1e-52|38.2|246/309| TM:NTM 7 TM:REGION 30->52| TM:REGION 91->113| TM:REGION 120->142| TM:REGION 145->167| TM:REGION 175->197| TM:REGION 218->240| TM:REGION 279->300| SEG 280->298|samavvffviivalsfvll| BL:PDB:NREP 1 BL:PDB:REP 31->261|3fh6F|7e-16|25.7|230/316| RP:PDB:NREP 2 RP:PDB:REP 22->183|3b8eA|1e-04|11.9|159/998| RP:PDB:REP 198->235|3dhwA|5e-05|28.9|38/203| RP:PFM:NREP 1 RP:PFM:REP 102->259|PF00528|2e-11|34.5|145/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 100->299|PF00528|5.5e-23|19.4|175/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 69->275|2r6gF2|3e-30|23.7|207/244|f.58.1.1| OP:NHOMO 3330 OP:NHOMOORG 607 OP:PATTERN 221-422145344452812331--8226114-----------------------3454111532---- ---1k213334-1123344-423349444444255514575437P*Y2BHH4PJN12C--868BI3EQaK68555EA71---4-------------------------1---------------------------8AA78---87221311-11442222222221333--2-----2----EE277DG-953222222331132223SG884722355B1945778777B*111111111111111-1---341-23--12122--22---1-42332324444322455566644454333344443333344---4443E4-3A111112151492--1446Y-36223C--231--1J--1886G2-1-------111112-FBC1--545537878788888G---6--4-1BQ--bYYLeaRpohYT11---9IA8769G95--------4112--12-----------------------------2---2-1433378988752444559C5554347572223--2238-23342668E----1--3--------------1-2--11---21121---------222225----------1------------------125-----1-6----------------------1---------36881513333333333-33333334333323333325656611124223222222222227-213333--488888888888---------11112-86E111212-----1--2----------1-22222344522333656-----------222111113143311111111111111---1---------------161111-----11--111----32---7LFCAAS9DB-2- --------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------------------------1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 240 STR:RPRED 76.9 SQ:SECSTR #####################cccccHHHHHTTTccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccTHHHHTTTTTcccccHHHHHHHHHHHHHHHHHHcccccTTcccccHHHHHHHHHHHHHHHHHcTTGGGcccccccTcccTTTTTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHTcHHHHHHHccccccccccc################################################### DISOP:02AL 5-26, 303-312| PSIPRED cccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHEEccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //