[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK88263.2
DDBJ      :             transcriptional regulator, MarR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  77/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:143 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->140 2fbhA PDBj 7e-09 32.5 %
:RPS:PDB   7->136 3bpxB PDBj 8e-17 18.5 %
:RPS:SCOP  8->134 3broA1  a.4.5.28 * 6e-18 22.0 %
:HMM:SCOP  3->139 1jgsA_ a.4.5.28 * 4.4e-27 25.7 %
:RPS:PFM   33->89 PF01047 * MarR 7e-04 31.6 %
:HMM:PFM   33->91 PF01047 * MarR 1.6e-13 23.7 59/59  
:BLT:SWISS 28->132 YHBI_BACSU 1e-08 25.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88263.2 GT:GENE AAK88263.2 GT:PRODUCT transcriptional regulator, MarR family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2505203..2505634 GB:FROM 2505203 GB:TO 2505634 GB:DIRECTION + GB:PRODUCT transcriptional regulator, MarR family GB:PROTEIN_ID AAK88263.2 GB:DB_XREF GI:159140516 LENGTH 143 SQ:AASEQ MSYQFTDSVPYLLNWVGVRLGERFSVRLTSYDITLPMYRVLATLRQQESKTLTELSDMVSVEISTLSRLVGLMVRRNLVSRERPADNARIVCISLTTKGEELADELMPIAAMFEKTAIEGLDPGEVKLFKSILRHIGLNIAGL GT:EXON 1|1-143:0| BL:SWS:NREP 1 BL:SWS:REP 28->132|YHBI_BACSU|1e-08|25.7|105/154| BL:PDB:NREP 1 BL:PDB:REP 27->140|2fbhA|7e-09|32.5|114/137| RP:PDB:NREP 1 RP:PDB:REP 7->136|3bpxB|8e-17|18.5|130/138| RP:PFM:NREP 1 RP:PFM:REP 33->89|PF01047|7e-04|31.6|57/59|MarR| HM:PFM:NREP 1 HM:PFM:REP 33->91|PF01047|1.6e-13|23.7|59/59|MarR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01047|IPR000835| GO:PFM GO:0005622|"GO:intracellular"|PF01047|IPR000835| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01047|IPR000835| RP:SCP:NREP 1 RP:SCP:REP 8->134|3broA1|6e-18|22.0|127/135|a.4.5.28| HM:SCP:REP 3->139|1jgsA_|4.4e-27|25.7|136/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 80 OP:NHOMOORG 77 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------1------------------------------------------------1--------------1------------------------111111-1-1111-1-1----1---------1--1-1--------------------------------------------------------1-----------------------------------------------1-1---------1----------1---------------------------1--1------------------1---------1---211----1-1-1--1---1------------------------------------------------------1-2-------------11111--1111111-112--1-----1-------1-1--1-----------------1------------------1-1--11-----------------------------------------------1-----11-111--1-111---------------------------------------------------------------------------------------------------------------1---------------------------------------------1-------------------1----------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 143 STR:RPRED 100.0 SQ:SECSTR ccHHHTccHHHHHHHHHHHHHHHHHHHHGGGTccHHHHHHHHHHHHcTTccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHTTTccHHHHHHHHHHHHHHHHHTcHc DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccc //